Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 522236..522872 | Replicon | chromosome |
| Accession | NZ_CP110264 | ||
| Organism | Bacillus halotolerans strain HMB20199 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | OMK57_RS02670 | Protein ID | WP_003156187.1 |
| Coordinates | 522522..522872 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | OMK57_RS02665 | Protein ID | WP_003225183.1 |
| Coordinates | 522236..522517 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMK57_RS02645 (OMK57_02645) | 518593..519192 | - | 600 | WP_264798263.1 | rhomboid family intramembrane serine protease | - |
| OMK57_RS02650 (OMK57_02650) | 519287..519652 | + | 366 | WP_069487530.1 | holo-ACP synthase | - |
| OMK57_RS02655 (OMK57_02655) | 519818..520834 | + | 1017 | WP_082687822.1 | outer membrane lipoprotein carrier protein LolA | - |
| OMK57_RS02660 (OMK57_02660) | 520951..522120 | + | 1170 | WP_044161733.1 | alanine racemase | - |
| OMK57_RS02665 (OMK57_02665) | 522236..522517 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| OMK57_RS02670 (OMK57_02670) | 522522..522872 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OMK57_RS02675 (OMK57_02675) | 522990..523814 | + | 825 | WP_082687807.1 | RsbT co-antagonist protein RsbRA | - |
| OMK57_RS02680 (OMK57_02680) | 523819..524184 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| OMK57_RS02685 (OMK57_02685) | 524188..524589 | + | 402 | WP_024714447.1 | serine/threonine-protein kinase RsbT | - |
| OMK57_RS02690 (OMK57_02690) | 524601..525608 | + | 1008 | WP_044161721.1 | phosphoserine phosphatase RsbU | - |
| OMK57_RS02695 (OMK57_02695) | 525669..525998 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
| OMK57_RS02700 (OMK57_02700) | 525995..526477 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
| OMK57_RS02705 (OMK57_02705) | 526443..527231 | + | 789 | WP_024120303.1 | RNA polymerase sigma factor SigB | - |
| OMK57_RS02710 (OMK57_02710) | 527231..527830 | + | 600 | WP_044161719.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T263523 WP_003156187.1 NZ_CP110264:522522-522872 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|