Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 278405..279044 | Replicon | chromosome |
Accession | NZ_CP110263 | ||
Organism | Peribacillus frigoritolerans strain HMB20428 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | OMJ04_RS01430 | Protein ID | WP_034306610.1 |
Coordinates | 278694..279044 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OMJ04_RS01425 | Protein ID | WP_034306380.1 |
Coordinates | 278405..278686 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMJ04_RS01405 (OMJ04_01405) | 274543..275133 | - | 591 | WP_264896144.1 | rhomboid family intramembrane serine protease | - |
OMJ04_RS01410 (OMJ04_01410) | 275241..275591 | + | 351 | WP_053537119.1 | holo-ACP synthase | - |
OMJ04_RS01415 (OMJ04_01415) | 275835..276839 | + | 1005 | WP_053537120.1 | outer membrane lipoprotein carrier protein LolA | - |
OMJ04_RS01420 (OMJ04_01420) | 277057..278244 | + | 1188 | WP_264897336.1 | alanine racemase | - |
OMJ04_RS01425 (OMJ04_01425) | 278405..278686 | + | 282 | WP_034306380.1 | antitoxin EndoAI | Antitoxin |
OMJ04_RS01430 (OMJ04_01430) | 278694..279044 | + | 351 | WP_034306610.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OMJ04_RS01435 (OMJ04_01435) | 279460..280287 | + | 828 | WP_054398282.1 | RsbT co-antagonist protein RsbRA | - |
OMJ04_RS01440 (OMJ04_01440) | 280290..280646 | + | 357 | WP_048682053.1 | STAS domain-containing protein | - |
OMJ04_RS01445 (OMJ04_01445) | 280650..281051 | + | 402 | WP_053537122.1 | anti-sigma regulatory factor | - |
OMJ04_RS01450 (OMJ04_01450) | 281061..282071 | + | 1011 | WP_264896145.1 | PP2C family protein-serine/threonine phosphatase | - |
OMJ04_RS01455 (OMJ04_01455) | 282131..282463 | + | 333 | WP_034306369.1 | anti-sigma factor antagonist | - |
OMJ04_RS01460 (OMJ04_01460) | 282460..282933 | + | 474 | WP_053537124.1 | anti-sigma B factor RsbW | - |
OMJ04_RS01465 (OMJ04_01465) | 282911..283699 | + | 789 | WP_034306363.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12955.06 Da Isoelectric Point: 7.2029
>T263522 WP_034306610.1 NZ_CP110263:278694-279044 [Peribacillus frigoritolerans]
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|