Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 80780..81405 | Replicon | plasmid pKBSW16i-A |
Accession | NZ_CP110261 | ||
Organism | Escherichia albertii strain KBSW16i |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N6N74_RS23485 | Protein ID | WP_000911333.1 |
Coordinates | 81007..81405 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | N6N74_RS23480 | Protein ID | WP_000450520.1 |
Coordinates | 80780..81007 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6N74_RS23480 (80780) | 80780..81007 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N6N74_RS23485 (81007) | 81007..81405 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
N6N74_RS23490 (81414) | 81414..81710 | - | 297 | Protein_86 | conjugal transfer protein TraD | - |
N6N74_RS23495 (81741) | 81741..83312 | - | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
N6N74_RS23500 (83332) | 83332..83679 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
N6N74_RS23505 (83679) | 83679..84356 | - | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
N6N74_RS23510 (84409) | 84409..86274 | - | 1866 | Protein_90 | type IV conjugative transfer system coupling protein TraD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3'')-Ib / sitABCD | vat / iutA / iucD / iucC / iucB / iucA | 1..148447 | 148447 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T263516 WP_000911333.1 NZ_CP110261:81007-81405 [Escherichia albertii]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|