Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 65453..65988 Replicon plasmid pKBSW16i-A
Accession NZ_CP110261
Organism Escherichia albertii strain KBSW16i

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag N6N74_RS23395 Protein ID WP_000222766.1
Coordinates 65453..65740 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag N6N74_RS23400 Protein ID WP_001132900.1
Coordinates 65737..65988 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N74_RS23375 (62885) 62885..63079 + 195 Protein_63 IS91 family transposase -
N6N74_RS23380 (63358) 63358..63615 + 258 Protein_64 IS3 family transposase -
N6N74_RS23385 (63683) 63683..63922 + 240 Protein_65 IS30 family transposase -
N6N74_RS23390 (64026) 64026..65188 + 1163 WP_269030130.1 IS3 family transposase -
N6N74_RS23395 (65453) 65453..65740 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N6N74_RS23400 (65737) 65737..65988 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N6N74_RS23405 (66955) 66955..67812 - 858 WP_262930268.1 incFII family plasmid replication initiator RepA -
N6N74_RS23410 (67831) 67831..68011 - 181 Protein_70 protein CopA/IncA -
N6N74_RS23415 (68115) 68115..68372 - 258 WP_000083826.1 replication regulatory protein RepA -
N6N74_RS23420 (68612) 68612..68746 - 135 Protein_72 hypothetical protein -
N6N74_RS23425 (68772) 68772..70385 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
N6N74_RS23430 (70416) 70416..70766 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3'')-Ib / sitABCD vat / iutA / iucD / iucC / iucB / iucA 1..148447 148447
- inside IScluster/Tn - - 63358..71188 7830


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T263515 WP_000222766.1 NZ_CP110261:c65740-65453 [Escherichia albertii]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT263515 WP_001132900.1 NZ_CP110261:c65988-65737 [Escherichia albertii]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References