Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3878302..3878953 | Replicon | chromosome |
| Accession | NZ_CP110260 | ||
| Organism | Escherichia albertii strain KBSW16i | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A8D9PM36 |
| Locus tag | N6N74_RS19105 | Protein ID | WP_044714929.1 |
| Coordinates | 3878549..3878953 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N6N74_RS19100 | Protein ID | WP_000354046.1 |
| Coordinates | 3878302..3878568 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N74_RS19070 (3873311) | 3873311..3874204 | + | 894 | WP_025238419.1 | transporter | - |
| N6N74_RS19075 (3874252) | 3874252..3875685 | - | 1434 | WP_059239141.1 | 6-phospho-beta-glucosidase BglA | - |
| N6N74_RS19080 (3875730) | 3875730..3876041 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| N6N74_RS19085 (3876209) | 3876209..3876868 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| N6N74_RS19090 (3877070) | 3877070..3878050 | - | 981 | WP_059239129.1 | tRNA-modifying protein YgfZ | - |
| N6N74_RS19095 (3878082) | 3878082..3878312 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| N6N74_RS19100 (3878302) | 3878302..3878568 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N6N74_RS19105 (3878549) | 3878549..3878953 | + | 405 | WP_044714929.1 | protein YgfX | Toxin |
| N6N74_RS19110 (3878992) | 3878992..3879513 | - | 522 | WP_044714926.1 | flavodoxin FldB | - |
| N6N74_RS19115 (3879625) | 3879625..3880521 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N6N74_RS19120 (3880546) | 3880546..3881256 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N6N74_RS19125 (3881262) | 3881262..3882995 | + | 1734 | WP_059239127.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15835.76 Da Isoelectric Point: 10.2082
>T263512 WP_044714929.1 NZ_CP110260:3878549-3878953 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLCLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLCLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |