Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 2308418..2308994 | Replicon | chromosome |
Accession | NZ_CP110260 | ||
Organism | Escherichia albertii strain KBSW16i |
Toxin (Protein)
Gene name | shpA | Uniprot ID | D3GXZ2 |
Locus tag | N6N74_RS11555 | Protein ID | WP_001297643.1 |
Coordinates | 2308707..2308994 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A829G8Z0 |
Locus tag | N6N74_RS11550 | Protein ID | WP_000063156.1 |
Coordinates | 2308418..2308720 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6N74_RS11535 (2305014) | 2305014..2307164 | + | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
N6N74_RS11540 (2307214) | 2307214..2307417 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
N6N74_RS11545 (2307428) | 2307428..2308384 | + | 957 | WP_001297640.1 | GTPase | - |
N6N74_RS11550 (2308418) | 2308418..2308720 | - | 303 | WP_000063156.1 | BrnA antitoxin family protein | Antitoxin |
N6N74_RS11555 (2308707) | 2308707..2308994 | - | 288 | WP_001297643.1 | BrnT family toxin | Toxin |
N6N74_RS11560 (2309193) | 2309193..2309890 | - | 698 | Protein_2259 | IS1 family transposase | - |
N6N74_RS11565 (2309947) | 2309947..2310042 | + | 96 | Protein_2260 | dienelactone hydrolase family protein | - |
N6N74_RS11570 (2310188) | 2310188..2311420 | + | 1233 | WP_262930122.1 | multidrug efflux MFS transporter MdtM | - |
N6N74_RS11575 (2311461) | 2311461..2312741 | + | 1281 | WP_001037380.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2309193..2309402 | 209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11295.77 Da Isoelectric Point: 6.8821
>T263509 WP_001297643.1 NZ_CP110260:c2308994-2308707 [Escherichia albertii]
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829GEV9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G8Z0 |