Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1595806..1596424 | Replicon | chromosome |
| Accession | NZ_CP110260 | ||
| Organism | Escherichia albertii strain KBSW16i | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | N6N74_RS07985 | Protein ID | WP_001280991.1 |
| Coordinates | 1596206..1596424 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | N6N74_RS07980 | Protein ID | WP_000344798.1 |
| Coordinates | 1595806..1596180 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N74_RS07970 (1590886) | 1590886..1592079 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N6N74_RS07975 (1592102) | 1592102..1595251 | + | 3150 | WP_262930144.1 | efflux RND transporter permease AcrB | - |
| N6N74_RS07980 (1595806) | 1595806..1596180 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| N6N74_RS07985 (1596206) | 1596206..1596424 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| N6N74_RS07990 (1596601) | 1596601..1597158 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| N6N74_RS07995 (1597265) | 1597265..1597735 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| N6N74_RS08000 (1597899) | 1597899..1599449 | + | 1551 | WP_001260378.1 | EAL domain-containing protein | - |
| N6N74_RS08005 (1599487) | 1599487..1599840 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| N6N74_RS08015 (1600221) | 1600221..1600532 | + | 312 | WP_150003837.1 | MGMT family protein | - |
| N6N74_RS08020 (1600562) | 1600562..1601134 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T263507 WP_001280991.1 NZ_CP110260:1596206-1596424 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT263507 WP_000344798.1 NZ_CP110260:1595806-1596180 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|