Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 581593..582197 | Replicon | chromosome |
| Accession | NZ_CP110260 | ||
| Organism | Escherichia albertii strain KBSW16i | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B1EM00 |
| Locus tag | N6N74_RS02915 | Protein ID | WP_000638401.1 |
| Coordinates | 581811..582197 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | N6N74_RS02910 | Protein ID | WP_001195490.1 |
| Coordinates | 581593..581814 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N74_RS02895 (577843) | 577843..579294 | + | 1452 | WP_044716705.1 | tagaturonate reductase | - |
| N6N74_RS02900 (579499) | 579499..580413 | + | 915 | WP_024164792.1 | bestrophin family protein | - |
| N6N74_RS02905 (580417) | 580417..581175 | - | 759 | WP_044709411.1 | trans-aconitate 2-methyltransferase | - |
| N6N74_RS02910 (581593) | 581593..581814 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N6N74_RS02915 (581811) | 581811..582197 | + | 387 | WP_000638401.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N6N74_RS02920 (582277) | 582277..583698 | - | 1422 | WP_223274629.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| N6N74_RS02925 (583691) | 583691..587059 | - | 3369 | WP_262929948.1 | autotransporter-associated beta strand repeat-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14505.49 Da Isoelectric Point: 8.0833
>T263504 WP_000638401.1 NZ_CP110260:581811-582197 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRIRDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T5VDW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2S6PD20 |