Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 99212..99855 | Replicon | plasmid pKBSW50i-A |
Accession | NZ_CP110259 | ||
Organism | Escherichia albertii strain KBSW50i |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | N6N69_RS23065 | Protein ID | WP_096306143.1 |
Coordinates | 99439..99855 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | N6N69_RS23060 | Protein ID | WP_096306144.1 |
Coordinates | 99212..99442 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6N69_RS23035 (95282) | 95282..95809 | - | 528 | WP_000203268.1 | colicin B immunity protein | - |
N6N69_RS23040 (96052) | 96052..96867 | + | 816 | WP_000449473.1 | lipid II-degrading bacteriocin colicin M | - |
N6N69_RS23045 (96917) | 96917..97270 | - | 354 | WP_000864812.1 | colicin M immunity protein | - |
N6N69_RS23050 (97443) | 97443..98225 | - | 783 | WP_024127883.1 | site-specific integrase | - |
N6N69_RS23055 (98227) | 98227..98640 | - | 414 | WP_024241438.1 | hypothetical protein | - |
N6N69_RS23060 (99212) | 99212..99442 | + | 231 | WP_096306144.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
N6N69_RS23065 (99439) | 99439..99855 | + | 417 | WP_096306143.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N6N69_RS23070 (99930) | 99930..101495 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
N6N69_RS23075 (101480) | 101480..102502 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA | 1..125950 | 125950 | |
- | flank | IS/Tn | - | - | 102756..103133 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15102.56 Da Isoelectric Point: 7.2929
>T263499 WP_096306143.1 NZ_CP110259:99439-99855 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPKAVLKHLEQAVLCGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPKAVLKHLEQAVLCGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|