Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4420490..4421106 Replicon chromosome
Accession NZ_CP110258
Organism Escherichia albertii strain KBSW50i

Toxin (Protein)


Gene name vapC Uniprot ID A0A8D9PNC1
Locus tag N6N69_RS21405 Protein ID WP_044713737.1
Coordinates 4420490..4420864 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N6N69_RS21410 Protein ID WP_103054107.1
Coordinates 4420864..4421106 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6N69_RS21390 (4417993) 4417993..4418895 + 903 WP_000331386.1 formate dehydrogenase O subunit beta -
N6N69_RS21395 (4418892) 4418892..4419527 + 636 WP_000829019.1 formate dehydrogenase cytochrome b556 subunit -
N6N69_RS21400 (4419524) 4419524..4420453 + 930 WP_000027704.1 formate dehydrogenase accessory protein FdhE -
N6N69_RS21405 (4420490) 4420490..4420864 - 375 WP_044713737.1 type II toxin-antitoxin system VapC family toxin Toxin
N6N69_RS21410 (4420864) 4420864..4421106 - 243 WP_103054107.1 CopG family transcriptional regulator Antitoxin
N6N69_RS21415 (4421334) 4421334..4421552 - 219 WP_001314326.1 CopG family transcriptional regulator -
N6N69_RS21420 (4421951) 4421951..4422229 - 279 WP_103054106.1 hypothetical protein -
N6N69_RS21425 (4422291) 4422291..4422503 - 213 WP_103054105.1 hypothetical protein -
N6N69_RS21430 (4422588) 4422588..4422653 - 66 Protein_4180 transcriptional regulator -
N6N69_RS21435 (4422671) 4422671..4423612 - 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
N6N69_RS21440 (4423657) 4423657..4424094 - 438 WP_000560977.1 D-aminoacyl-tRNA deacylase -
N6N69_RS21445 (4424091) 4424091..4424963 - 873 WP_000916663.1 virulence factor BrkB family protein -
N6N69_RS21450 (4424957) 4424957..4425556 - 600 WP_002460585.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(15-48)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13940.21 Da        Isoelectric Point: 9.4803

>T263495 WP_044713737.1 NZ_CP110258:c4420864-4420490 [Escherichia albertii]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLAGAKKYNQEHRIRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVITPYQP

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9272.61 Da        Isoelectric Point: 4.4819

>AT263495 WP_103054107.1 NZ_CP110258:c4421106-4420864 [Escherichia albertii]
MSAMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVAQYLENQSKTTIFSALGIWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References