Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3403715..3404333 | Replicon | chromosome |
Accession | NZ_CP110258 | ||
Organism | Escherichia albertii strain KBSW50i |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N6N69_RS16620 | Protein ID | WP_001280991.1 |
Coordinates | 3404115..3404333 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | N6N69_RS16615 | Protein ID | WP_000344798.1 |
Coordinates | 3403715..3404089 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6N69_RS16605 (3398795) | 3398795..3399988 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N6N69_RS16610 (3400011) | 3400011..3403160 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
N6N69_RS16615 (3403715) | 3403715..3404089 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
N6N69_RS16620 (3404115) | 3404115..3404333 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N6N69_RS16625 (3404510) | 3404510..3405067 | + | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
N6N69_RS16630 (3405175) | 3405175..3405645 | + | 471 | WP_059224581.1 | YlaC family protein | - |
N6N69_RS16635 (3405809) | 3405809..3407359 | + | 1551 | WP_262930572.1 | EAL domain-containing protein | - |
N6N69_RS16640 (3407397) | 3407397..3407750 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
N6N69_RS16650 (3408131) | 3408131..3408442 | + | 312 | WP_000409915.1 | MGMT family protein | - |
N6N69_RS16655 (3408472) | 3408472..3409044 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T263489 WP_001280991.1 NZ_CP110258:3404115-3404333 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT263489 WP_000344798.1 NZ_CP110258:3403715-3404089 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|