Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 915220..915871 | Replicon | chromosome |
| Accession | NZ_CP110258 | ||
| Organism | Escherichia albertii strain KBSW50i | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A8D9PM36 |
| Locus tag | N6N69_RS04495 | Protein ID | WP_044714929.1 |
| Coordinates | 915467..915871 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N6N69_RS04490 | Protein ID | WP_000354046.1 |
| Coordinates | 915220..915486 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6N69_RS04465 (910932) | 910932..912365 | - | 1434 | WP_025238420.1 | 6-phospho-beta-glucosidase BglA | - |
| N6N69_RS04470 (912410) | 912410..912721 | + | 312 | WP_001182937.1 | N(4)-acetylcytidine aminohydrolase | - |
| N6N69_RS04475 (912889) | 912889..913548 | + | 660 | WP_000250281.1 | hemolysin III family protein | - |
| N6N69_RS04480 (913988) | 913988..914968 | - | 981 | WP_103053871.1 | tRNA-modifying protein YgfZ | - |
| N6N69_RS04485 (915000) | 915000..915230 | + | 231 | WP_000181267.1 | hypothetical protein | - |
| N6N69_RS04490 (915220) | 915220..915486 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N6N69_RS04495 (915467) | 915467..915871 | + | 405 | WP_044714929.1 | protein YgfX | Toxin |
| N6N69_RS04500 (915910) | 915910..916431 | - | 522 | WP_044714926.1 | flavodoxin FldB | - |
| N6N69_RS04505 (916543) | 916543..917439 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N6N69_RS04510 (917464) | 917464..918174 | + | 711 | WP_000748106.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N6N69_RS04515 (918180) | 918180..919913 | + | 1734 | WP_105227436.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15835.76 Da Isoelectric Point: 10.2082
>T263481 WP_044714929.1 NZ_CP110258:915467-915871 [Escherichia albertii]
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLCLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAAILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVRAPWMIKTGMMLCLLSDSGKRQHLWLAADSMDEAEWRDLRRILLQQEIQ
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |