Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 302059..302859 | Replicon | chromosome |
Accession | NZ_CP110258 | ||
Organism | Escherichia albertii strain KBSW50i |
Toxin (Protein)
Gene name | ataT | Uniprot ID | B1EHN9 |
Locus tag | N6N69_RS01450 | Protein ID | WP_000342453.1 |
Coordinates | 302332..302859 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | N6N69_RS01445 | Protein ID | WP_098401847.1 |
Coordinates | 302059..302325 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6N69_RS01420 | 297780..298634 | - | 855 | WP_105227881.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
N6N69_RS01425 | 298627..299373 | - | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
N6N69_RS01430 | 299390..299875 | - | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
N6N69_RS01435 | 299882..300283 | - | 402 | WP_262930538.1 | PTS sugar transporter subunit IIA | - |
N6N69_RS01440 | 300806..301909 | + | 1104 | WP_105227877.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
N6N69_RS01445 | 302059..302325 | + | 267 | WP_098401847.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
N6N69_RS01450 | 302332..302859 | + | 528 | WP_000342453.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
N6N69_RS01455 | 302856..303239 | - | 384 | WP_103054016.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
N6N69_RS01460 | 303663..304772 | + | 1110 | WP_000827693.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
N6N69_RS01465 | 304820..305746 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
N6N69_RS01470 | 305743..307020 | + | 1278 | WP_059228517.1 | branched chain amino acid ABC transporter permease LivM | - |
N6N69_RS01475 | 307017..307784 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19676.58 Da Isoelectric Point: 6.9585
>T263478 WP_000342453.1 NZ_CP110258:302332-302859 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|