Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5628..6247 Replicon plasmid unnamed4
Accession NZ_CP110241
Organism Vagococcus sp. STAA25

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag OL235_RS10745 Protein ID WP_275470198.1
Coordinates 5628..5819 (+) Length 64 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag OL235_RS10750 Protein ID WP_275470199.1
Coordinates 5861..6247 (+) Length 129 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OL235_RS10685 (OL235_10685) 699..914 + 216 WP_275470188.1 hypothetical protein -
OL235_RS10690 (OL235_10690) 1000..1257 + 258 WP_275470189.1 hypothetical protein -
OL235_RS10695 (OL235_10695) 1257..1964 + 708 WP_275470190.1 ERF family protein -
OL235_RS10700 (OL235_10700) 1975..2706 + 732 WP_275470191.1 putative HNHc nuclease -
OL235_RS10705 (OL235_10705) 2725..3633 + 909 WP_275470192.1 phage replisome organizer N-terminal domain-containing protein -
OL235_RS10710 (OL235_10710) 3646..3840 + 195 WP_275470193.1 hypothetical protein -
OL235_RS10715 (OL235_10715) 3818..4267 + 450 WP_275470194.1 DUF1064 domain-containing protein -
OL235_RS10720 (OL235_10720) 4276..4461 + 186 WP_275470322.1 hypothetical protein -
OL235_RS10725 (OL235_10725) 4463..4660 + 198 WP_275470196.1 hypothetical protein -
OL235_RS10730 (OL235_10730) 4676..5089 + 414 WP_275470323.1 hypothetical protein -
OL235_RS10745 (OL235_10745) 5628..5819 + 192 WP_275470198.1 type II toxin-antitoxin system HicA family toxin Toxin
OL235_RS10750 (OL235_10750) 5861..6247 + 387 WP_275470199.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OL235_RS10755 (OL235_10755) 6488..6769 + 282 WP_275470200.1 hypothetical protein -
OL235_RS10760 (OL235_10760) 6805..7569 + 765 WP_275470201.1 terminase small subunit -
OL235_RS10765 (OL235_10765) 7554..8849 + 1296 WP_275470202.1 PBSX family phage terminase large subunit -
OL235_RS10770 (OL235_10770) 8860..10248 + 1389 WP_275470203.1 phage portal protein -
OL235_RS10775 (OL235_10775) 10373..10681 + 309 WP_275470205.1 ribosomal-processing cysteine protease Prp -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..42431 42431


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-62)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-105)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 6895.22 Da        Isoelectric Point: 10.6954

>T263475 WP_275470198.1 NZ_CP110241:5628-5819 [Vagococcus sp. STAA25]
MPMTIKEAEQLLKDSGFIEVKGGKGSHRKFIKAGCTRPMILTSHGKELSRVVEQSVLKAVGLK

Download         Length: 192 bp

Antitoxin


Download         Length: 129 a.a.        Molecular weight: 14188.99 Da        Isoelectric Point: 4.0705

>AT263475 WP_275470199.1 NZ_CP110241:5861-6247 [Vagococcus sp. STAA25]
VKKVYPAIFEEDEVGYGIYFPDVEGAVTQGDSIQNGLEMASDALGIILADMLESGEDLPKASKINEVSYEENEQFVTLVS
VDLTDYLKDGKLDKKTITIPHWLNMRAKQSGINFSETLTTALENKLNL

Download         Length: 387 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References