Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 6064..6647 Replicon plasmid unnamed3
Accession NZ_CP110235
Organism Vagococcus sp. STAA11

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OL234_RS10895 Protein ID WP_275470245.1
Coordinates 6357..6647 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID -
Locus tag OL234_RS10890 Protein ID WP_275470244.1
Coordinates 6064..6351 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OL234_RS10850 (OL234_10850) 1712..1963 - 252 WP_275470238.1 hypothetical protein -
OL234_RS10855 (OL234_10855) 2361..2786 + 426 WP_275470250.1 cupin domain-containing protein -
OL234_RS10860 (OL234_10860) 3081..3374 - 294 WP_275470239.1 bacteriocin immunity protein -
OL234_RS10865 (OL234_10865) 3694..3985 - 292 Protein_5 type II toxin-antitoxin system YafQ family toxin -
OL234_RS10870 (OL234_10870) 3994..4278 - 285 WP_275470240.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
OL234_RS10875 (OL234_10875) 4447..4662 - 216 WP_275470241.1 hypothetical protein -
OL234_RS10880 (OL234_10880) 4809..5021 - 213 WP_275470242.1 hypothetical protein -
OL234_RS10885 (OL234_10885) 5045..5434 - 390 WP_275470243.1 hypothetical protein -
OL234_RS10890 (OL234_10890) 6064..6351 + 288 WP_275470244.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OL234_RS10895 (OL234_10895) 6357..6647 + 291 WP_275470245.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
OL234_RS10900 (OL234_10900) 6644..6976 - 333 WP_275470246.1 hypothetical protein -
OL234_RS10905 (OL234_10905) 7051..7422 + 372 WP_275470247.1 MobC family plasmid mobilization relaxosome protein -
OL234_RS10910 (OL234_10910) 7467..7691 + 225 WP_275470248.1 hypothetical protein -
OL234_RS10915 (OL234_10915) 7666..8814 + 1149 WP_275470249.1 relaxase/mobilization nuclease domain-containing protein -
OL234_RS10920 (OL234_10920) 9609..10778 + 1170 WP_275470227.1 RepB family plasmid replication initiator protein -
OL234_RS10925 (OL234_10925) 10781..11329 + 549 WP_275470228.1 DUF536 domain-containing protein -
OL234_RS10930 (OL234_10930) 11349..11549 - 201 WP_275470229.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..16537 16537


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-96)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(8-75)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11522.40 Da        Isoelectric Point: 8.4816

>T263473 WP_275470245.1 NZ_CP110235:6357-6647 [Vagococcus sp. STAA11]
MLEMKQTTKFKKDLKRLKKRNANLEKLKTVMQMIVEEVPLPEEEYRAHILEPTKDYLDCWECHISGRNSDWLLIYKFYPS
QNLVSFIRTGSHSDVF

Download         Length: 291 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10558.03 Da        Isoelectric Point: 8.5613

>AT263473 WP_275470244.1 NZ_CP110235:6064-6351 [Vagococcus sp. STAA11]
VETKQKKAVIQVRIDETVKSQAVAVLNNLGMDTSTAINVFFRQVIAENGLPFQPKQAKFNAETLAAIKESDEMVQNRTGK
RYTSIDNLFKDALGD

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References