Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 7102..7721 Replicon plasmid unnamed1
Accession NZ_CP110233
Organism Vagococcus sp. STAA11

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag OL234_RS10570 Protein ID WP_275470198.1
Coordinates 7102..7293 (+) Length 64 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag OL234_RS10575 Protein ID WP_275470199.1
Coordinates 7335..7721 (+) Length 129 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OL234_RS10510 (OL234_10510) 2173..2388 + 216 WP_275470188.1 hypothetical protein -
OL234_RS10515 (OL234_10515) 2474..2731 + 258 WP_275470189.1 hypothetical protein -
OL234_RS10520 (OL234_10520) 2731..3438 + 708 WP_275470190.1 ERF family protein -
OL234_RS10525 (OL234_10525) 3449..4180 + 732 WP_275470191.1 putative HNHc nuclease -
OL234_RS10530 (OL234_10530) 4199..5107 + 909 WP_275470192.1 phage replisome organizer N-terminal domain-containing protein -
OL234_RS10535 (OL234_10535) 5120..5314 + 195 WP_275470193.1 hypothetical protein -
OL234_RS10540 (OL234_10540) 5292..5741 + 450 WP_275470194.1 DUF1064 domain-containing protein -
OL234_RS10545 (OL234_10545) 5768..5935 + 168 WP_275470195.1 hypothetical protein -
OL234_RS10550 (OL234_10550) 5937..6134 + 198 WP_275470196.1 hypothetical protein -
OL234_RS10555 (OL234_10555) 6171..6563 + 393 WP_275470197.1 hypothetical protein -
OL234_RS10570 (OL234_10570) 7102..7293 + 192 WP_275470198.1 type II toxin-antitoxin system HicA family toxin Toxin
OL234_RS10575 (OL234_10575) 7335..7721 + 387 WP_275470199.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OL234_RS10580 (OL234_10580) 7962..8243 + 282 WP_275470200.1 hypothetical protein -
OL234_RS10585 (OL234_10585) 8279..9043 + 765 WP_275470201.1 terminase small subunit -
OL234_RS10590 (OL234_10590) 9028..10323 + 1296 WP_275470202.1 PBSX family phage terminase large subunit -
OL234_RS10595 (OL234_10595) 10334..11722 + 1389 WP_275470203.1 phage portal protein -
OL234_RS10600 (OL234_10600) 11719..11850 + 132 WP_275470204.1 hypothetical protein -
OL234_RS10605 (OL234_10605) 11847..12155 + 309 WP_275470205.1 ribosomal-processing cysteine protease Prp -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..42431 42431


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-62)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-105)


Sequences

Toxin        


Download         Length: 64 a.a.        Molecular weight: 6895.22 Da        Isoelectric Point: 10.6954

>T263471 WP_275470198.1 NZ_CP110233:7102-7293 [Vagococcus sp. STAA11]
MPMTIKEAEQLLKDSGFIEVKGGKGSHRKFIKAGCTRPMILTSHGKELSRVVEQSVLKAVGLK

Download         Length: 192 bp

Antitoxin


Download         Length: 129 a.a.        Molecular weight: 14188.99 Da        Isoelectric Point: 4.0705

>AT263471 WP_275470199.1 NZ_CP110233:7335-7721 [Vagococcus sp. STAA11]
VKKVYPAIFEEDEVGYGIYFPDVEGAVTQGDSIQNGLEMASDALGIILADMLESGEDLPKASKINEVSYEENEQFVTLVS
VDLTDYLKDGKLDKKTITIPHWLNMRAKQSGINFSETLTTALENKLNL

Download         Length: 387 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References