Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 2360520..2361058 | Replicon | chromosome |
Accession | NZ_CP110231 | ||
Organism | Selenomonas sputigena strain KCOM 20461 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OL240_RS10790 | Protein ID | WP_264918409.1 |
Coordinates | 2360520..2360795 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | F4EYL4 |
Locus tag | OL240_RS10795 | Protein ID | WP_013740585.1 |
Coordinates | 2360792..2361058 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OL240_RS10775 (OL240_10775) | 2355903..2357972 | + | 2070 | WP_264918405.1 | sulfatase-like hydrolase/transferase | - |
OL240_RS10780 (OL240_10780) | 2358051..2358899 | + | 849 | WP_264918406.1 | glycosyltransferase | - |
OL240_RS10785 (OL240_10785) | 2358961..2360385 | + | 1425 | WP_264918408.1 | [FeFe] hydrogenase H-cluster radical SAM maturase HydG | - |
OL240_RS10790 (OL240_10790) | 2360520..2360795 | - | 276 | WP_264918409.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OL240_RS10795 (OL240_10795) | 2360792..2361058 | - | 267 | WP_013740585.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OL240_RS10800 (OL240_10800) | 2361396..2361659 | + | 264 | WP_264918410.1 | helix-turn-helix transcriptional regulator | - |
OL240_RS10805 (OL240_10805) | 2361874..2362068 | + | 195 | WP_264918411.1 | sulfur carrier protein ThiS | - |
OL240_RS10810 (OL240_10810) | 2362162..2362959 | + | 798 | WP_264918412.1 | thiazole synthase | - |
OL240_RS10815 (OL240_10815) | 2362956..2364212 | + | 1257 | WP_264918414.1 | 2-iminoacetate synthase ThiH | - |
OL240_RS10820 (OL240_10820) | 2364205..2364795 | + | 591 | WP_264918416.1 | thiamine phosphate synthase | - |
OL240_RS10825 (OL240_10825) | 2364941..2365969 | - | 1029 | WP_264918418.1 | nuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10485.23 Da Isoelectric Point: 9.1381
>T263470 WP_264918409.1 NZ_CP110231:c2360795-2360520 [Selenomonas sputigena]
MKYKIIPTARFRKDVKTAAKRGLPICRLEEIVDQLAAGTPLPERNRDHALTGTFAGYRECHILPDWLLVYRIDNEILTLL
LHRTGTHSDLF
MKYKIIPTARFRKDVKTAAKRGLPICRLEEIVDQLAAGTPLPERNRDHALTGTFAGYRECHILPDWLLVYRIDNEILTLL
LHRTGTHSDLF
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|