Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 2259289..2259841 | Replicon | chromosome |
Accession | NZ_CP110231 | ||
Organism | Selenomonas sputigena strain KCOM 20461 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OL240_RS10360 | Protein ID | WP_264918297.1 |
Coordinates | 2259289..2259567 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OL240_RS10365 | Protein ID | WP_264918299.1 |
Coordinates | 2259557..2259841 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OL240_RS10335 (OL240_10335) | 2254726..2255604 | + | 879 | WP_264918290.1 | GGDEF domain-containing protein | - |
OL240_RS10345 (OL240_10345) | 2255852..2256505 | - | 654 | WP_264918292.1 | TrkA family potassium uptake protein | - |
OL240_RS10350 (OL240_10350) | 2256516..2257838 | - | 1323 | WP_264918293.1 | TrkH family potassium uptake protein | - |
OL240_RS10355 (OL240_10355) | 2258094..2259209 | + | 1116 | WP_264918295.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OL240_RS10360 (OL240_10360) | 2259289..2259567 | - | 279 | WP_264918297.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
OL240_RS10365 (OL240_10365) | 2259557..2259841 | - | 285 | WP_264918299.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OL240_RS10370 (OL240_10370) | 2259948..2260850 | - | 903 | WP_264918301.1 | PRC-barrel domain-containing protein | - |
OL240_RS10375 (OL240_10375) | 2260907..2262928 | - | 2022 | WP_264918303.1 | tetratricopeptide repeat protein | - |
OL240_RS10380 (OL240_10380) | 2263240..2263506 | + | 267 | WP_006190627.1 | HPr family phosphocarrier protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10863.68 Da Isoelectric Point: 8.8288
>T263469 WP_264918297.1 NZ_CP110231:c2259567-2259289 [Selenomonas sputigena]
MQYELKYTRAFRRGYKRAKKRGLNLSLLGEIVEMLRCGKKLPKKYADHCLSGDFSQCRECHIQPDWLLVYRIDDDILTLT
LMDTGTHAELFH
MQYELKYTRAFRRGYKRAKKRGLNLSLLGEIVEMLRCGKKLPKKYADHCLSGDFSQCRECHIQPDWLLVYRIDDDILTLT
LMDTGTHAELFH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|