Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 230701..231251 Replicon chromosome
Accession NZ_CP110231
Organism Selenomonas sputigena strain KCOM 20461

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OL240_RS00965 Protein ID WP_264918910.1
Coordinates 230701..230982 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag OL240_RS00970 Protein ID WP_264918911.1
Coordinates 230979..231251 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OL240_RS00940 (OL240_00940) 226580..226715 + 136 Protein_185 magnesium chelatase -
OL240_RS00945 (OL240_00945) 226878..228005 + 1128 WP_264918907.1 YifB family Mg chelatase-like AAA ATPase -
OL240_RS00950 (OL240_00950) 228109..228411 + 303 WP_264918908.1 nucleotidyltransferase domain-containing protein -
OL240_RS00955 (OL240_00955) 228944..230344 + 1401 WP_264918909.1 group II intron reverse transcriptase/maturase -
OL240_RS00960 (OL240_00960) 230446..230691 + 246 Protein_189 HNH endonuclease -
OL240_RS00965 (OL240_00965) 230701..230982 - 282 WP_264918910.1 type II toxin-antitoxin system YafQ family toxin Toxin
OL240_RS00970 (OL240_00970) 230979..231251 - 273 WP_264918911.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
OL240_RS00975 (OL240_00975) 231483..231851 + 369 WP_264918912.1 hypothetical protein -
OL240_RS00980 (OL240_00980) 231878..232723 + 846 WP_264919819.1 IS3 family transposase -
OL240_RS00985 (OL240_00985) 232954..233456 + 503 Protein_194 terminase large subunit -
OL240_RS00990 (OL240_00990) 233458..233670 - 213 Protein_195 terminase large subunit -
OL240_RS00995 (OL240_00995) 233653..234147 + 495 Protein_196 terminase large subunit -
OL240_RS01000 (OL240_01000) 234195..234806 - 612 WP_264918913.1 hypothetical protein -
OL240_RS01005 (OL240_01005) 234928..235206 + 279 Protein_198 phage portal protein -
OL240_RS01010 (OL240_01010) 235210..235356 - 147 Protein_199 ABC transporter substrate-binding protein -
OL240_RS01015 (OL240_01015) 235372..235728 - 357 WP_264918914.1 helix-turn-helix domain-containing protein -
OL240_RS01020 (OL240_01020) 235851..236099 + 249 WP_264918915.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 218492..244337 25845


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-69)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11003.60 Da        Isoelectric Point: 8.0794

>T263467 WP_264918910.1 NZ_CP110231:c230982-230701 [Selenomonas sputigena]
MTYRIKFTSAYKKSYKRARKRGLNLKLLDDVVDVLRQGHKLDAKYRDHELHGNWAGFRECHIQPDWLLVYLVENDILTLT
LVETGTHADIFDE

Download         Length: 282 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10115.60 Da        Isoelectric Point: 5.0773

>AT263467 WP_264918911.1 NZ_CP110231:c231251-230979 [Selenomonas sputigena]
MSTVPTQIRIDRDIKEQAGILFSGLGLDMSGAVNMFLHQCVLRGGIPFSIEMPRYKQSTLAAMEEARRISRDPNAPSYDN
MDDLKRALEE

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References