Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 3928674..3929209 | Replicon | chromosome |
| Accession | NZ_CP110227 | ||
| Organism | Serratia rubidaea strain AO4-P6 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A4V6JGT0 |
| Locus tag | OLD77_RS18760 | Protein ID | WP_054305341.1 |
| Coordinates | 3928922..3929209 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OLD77_RS18755 | Protein ID | WP_269873428.1 |
| Coordinates | 3928674..3928925 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLD77_RS18730 (OLD77_18730) | 3924695..3925237 | - | 543 | WP_015671079.1 | hypothetical protein | - |
| OLD77_RS18735 (OLD77_18735) | 3925237..3925923 | - | 687 | WP_061324887.1 | acireductone synthase | - |
| OLD77_RS18740 (OLD77_18740) | 3925920..3926534 | - | 615 | WP_269873425.1 | methylthioribulose 1-phosphate dehydratase | - |
| OLD77_RS18745 (OLD77_18745) | 3926669..3927829 | + | 1161 | WP_015671076.1 | pyridoxal phosphate-dependent aminotransferase | - |
| OLD77_RS18750 (OLD77_18750) | 3927817..3928590 | + | 774 | WP_061324890.1 | amidohydrolase | - |
| OLD77_RS18755 (OLD77_18755) | 3928674..3928925 | + | 252 | WP_269873428.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OLD77_RS18760 (OLD77_18760) | 3928922..3929209 | + | 288 | WP_054305341.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OLD77_RS18765 (OLD77_18765) | 3929525..3930403 | - | 879 | WP_269873431.1 | siderophore-interacting protein | - |
| OLD77_RS18770 (OLD77_18770) | 3930425..3931627 | - | 1203 | WP_269873433.1 | MFS transporter | - |
| OLD77_RS18775 (OLD77_18775) | 3931766..3933511 | + | 1746 | WP_269873435.1 | IucA/IucC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10946.02 Da Isoelectric Point: 10.4726
>T263466 WP_054305341.1 NZ_CP110227:3928922-3929209 [Serratia rubidaea]
MTYKVKFRESALKEWNRLDKALQQQFAKKLKKCCENPHIPAAKLRGMPGCYKIKLRASGFRLVYEVIDDCLVIAVVAVGK
RERGSVYQLSSERLK
MTYKVKFRESALKEWNRLDKALQQQFAKKLKKCCENPHIPAAKLRGMPGCYKIKLRASGFRLVYEVIDDCLVIAVVAVGK
RERGSVYQLSSERLK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|