Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3767220..3767851 | Replicon | chromosome |
| Accession | NZ_CP110227 | ||
| Organism | Serratia rubidaea strain AO4-P6 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | L0MF14 |
| Locus tag | OLD77_RS17985 | Protein ID | WP_015671220.1 |
| Coordinates | 3767648..3767851 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A140F0B9 |
| Locus tag | OLD77_RS17980 | Protein ID | WP_061324804.1 |
| Coordinates | 3767220..3767588 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLD77_RS17945 (OLD77_17945) | 3763239..3763493 | + | 255 | WP_269873279.1 | type B 50S ribosomal protein L31 | - |
| OLD77_RS17950 (OLD77_17950) | 3763503..3763643 | + | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
| OLD77_RS17955 (OLD77_17955) | 3763741..3764616 | - | 876 | WP_269873291.1 | metal ABC transporter substrate-binding protein | - |
| OLD77_RS17960 (OLD77_17960) | 3764632..3765498 | - | 867 | WP_269873292.1 | metal ABC transporter permease | - |
| OLD77_RS17965 (OLD77_17965) | 3765495..3766199 | - | 705 | WP_061324803.1 | ABC transporter ATP-binding protein | - |
| OLD77_RS17970 (OLD77_17970) | 3766196..3766345 | - | 150 | WP_158510627.1 | hypothetical protein | - |
| OLD77_RS17975 (OLD77_17975) | 3766510..3766863 | + | 354 | WP_054305423.1 | hypothetical protein | - |
| OLD77_RS17980 (OLD77_17980) | 3767220..3767588 | + | 369 | WP_061324804.1 | Hha toxicity modulator TomB | Antitoxin |
| OLD77_RS17985 (OLD77_17985) | 3767648..3767851 | + | 204 | WP_015671220.1 | HHA domain-containing protein | Toxin |
| OLD77_RS17990 (OLD77_17990) | 3767932..3768864 | - | 933 | WP_269873295.1 | LysR family transcriptional regulator | - |
| OLD77_RS17995 (OLD77_17995) | 3769002..3770789 | + | 1788 | WP_269873296.1 | adenine deaminase C-terminal domain-containing protein | - |
| OLD77_RS18000 (OLD77_18000) | 3770859..3772202 | + | 1344 | WP_269873297.1 | NCS2 family permease | - |
| OLD77_RS18005 (OLD77_18005) | 3772237..3772659 | - | 423 | WP_269873298.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8049.33 Da Isoelectric Point: 7.9816
>T263465 WP_015671220.1 NZ_CP110227:3767648-3767851 [Serratia rubidaea]
MTKTDYLMRLRKCTTIDTLERVIEKNKYALSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYALSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14393.20 Da Isoelectric Point: 4.7790
>AT263465 WP_061324804.1 NZ_CP110227:3767220-3767588 [Serratia rubidaea]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSYKIKYMDESDFSELVEEYL
DDTYTLFSNYGINDSDLRRWQKTKRRLFRMFSGEVCCTKMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSYKIKYMDESDFSELVEEYL
DDTYTLFSNYGINDSDLRRWQKTKRRLFRMFSGEVCCTKMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A857EAE6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140F0B9 |