Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3767220..3767851 Replicon chromosome
Accession NZ_CP110227
Organism Serratia rubidaea strain AO4-P6

Toxin (Protein)


Gene name Hha Uniprot ID L0MF14
Locus tag OLD77_RS17985 Protein ID WP_015671220.1
Coordinates 3767648..3767851 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A140F0B9
Locus tag OLD77_RS17980 Protein ID WP_061324804.1
Coordinates 3767220..3767588 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLD77_RS17945 (OLD77_17945) 3763239..3763493 + 255 WP_269873279.1 type B 50S ribosomal protein L31 -
OLD77_RS17950 (OLD77_17950) 3763503..3763643 + 141 WP_004940304.1 type B 50S ribosomal protein L36 -
OLD77_RS17955 (OLD77_17955) 3763741..3764616 - 876 WP_269873291.1 metal ABC transporter substrate-binding protein -
OLD77_RS17960 (OLD77_17960) 3764632..3765498 - 867 WP_269873292.1 metal ABC transporter permease -
OLD77_RS17965 (OLD77_17965) 3765495..3766199 - 705 WP_061324803.1 ABC transporter ATP-binding protein -
OLD77_RS17970 (OLD77_17970) 3766196..3766345 - 150 WP_158510627.1 hypothetical protein -
OLD77_RS17975 (OLD77_17975) 3766510..3766863 + 354 WP_054305423.1 hypothetical protein -
OLD77_RS17980 (OLD77_17980) 3767220..3767588 + 369 WP_061324804.1 Hha toxicity modulator TomB Antitoxin
OLD77_RS17985 (OLD77_17985) 3767648..3767851 + 204 WP_015671220.1 HHA domain-containing protein Toxin
OLD77_RS17990 (OLD77_17990) 3767932..3768864 - 933 WP_269873295.1 LysR family transcriptional regulator -
OLD77_RS17995 (OLD77_17995) 3769002..3770789 + 1788 WP_269873296.1 adenine deaminase C-terminal domain-containing protein -
OLD77_RS18000 (OLD77_18000) 3770859..3772202 + 1344 WP_269873297.1 NCS2 family permease -
OLD77_RS18005 (OLD77_18005) 3772237..3772659 - 423 WP_269873298.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-117)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8049.33 Da        Isoelectric Point: 7.9816

>T263465 WP_015671220.1 NZ_CP110227:3767648-3767851 [Serratia rubidaea]
MTKTDYLMRLRKCTTIDTLERVIEKNKYALSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14393.20 Da        Isoelectric Point: 4.7790

>AT263465 WP_061324804.1 NZ_CP110227:3767220-3767588 [Serratia rubidaea]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSYKIKYMDESDFSELVEEYL
DDTYTLFSNYGINDSDLRRWQKTKRRLFRMFSGEVCCTKMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A857EAE6

Antitoxin

Source ID Structure
AlphaFold DB A0A140F0B9

References