Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1613263..1613906 | Replicon | chromosome |
| Accession | NZ_CP110227 | ||
| Organism | Serratia rubidaea strain AO4-P6 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | OLD77_RS07470 | Protein ID | WP_269875370.1 |
| Coordinates | 1613263..1613679 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A126VIW5 |
| Locus tag | OLD77_RS07475 | Protein ID | WP_061322715.1 |
| Coordinates | 1613676..1613906 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLD77_RS07455 (OLD77_07455) | 1608456..1610111 | - | 1656 | WP_269875368.1 | BCCT family transporter | - |
| OLD77_RS07460 (OLD77_07460) | 1610403..1611779 | + | 1377 | WP_054307157.1 | L-serine ammonia-lyase | - |
| OLD77_RS07465 (OLD77_07465) | 1612059..1613213 | + | 1155 | WP_269875369.1 | GlxA family transcriptional regulator | - |
| OLD77_RS07470 (OLD77_07470) | 1613263..1613679 | - | 417 | WP_269875370.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OLD77_RS07475 (OLD77_07475) | 1613676..1613906 | - | 231 | WP_061322715.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OLD77_RS07480 (OLD77_07480) | 1614224..1615201 | + | 978 | WP_269875371.1 | dipeptidase | - |
| OLD77_RS07485 (OLD77_07485) | 1615233..1615763 | + | 531 | WP_015673099.1 | DUF5943 domain-containing protein | - |
| OLD77_RS07490 (OLD77_07490) | 1615820..1617883 | + | 2064 | WP_015673098.1 | dimethylglycine demethylation protein DgcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14854.19 Da Isoelectric Point: 7.8276
>T263459 WP_269875370.1 NZ_CP110227:c1613679-1613263 [Serratia rubidaea]
MSHTYMLDTCICSYIMREQPAAAIRRLEQAVMQRHRIVVSAITYAEMRFGAIGKKASPRHAQLVEAFCSRLDAILPWDRA
AVDETTALKAALAAAGTPIGPNDTAIAGHAIAAGAILVTNNHKEFARVPGLALEDWAA
MSHTYMLDTCICSYIMREQPAAAIRRLEQAVMQRHRIVVSAITYAEMRFGAIGKKASPRHAQLVEAFCSRLDAILPWDRA
AVDETTALKAALAAAGTPIGPNDTAIAGHAIAAGAILVTNNHKEFARVPGLALEDWAA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|