Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 978187..978853 | Replicon | chromosome |
Accession | NZ_CP110227 | ||
Organism | Serratia rubidaea strain AO4-P6 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A4V6JI41 |
Locus tag | OLD77_RS04580 | Protein ID | WP_054306177.1 |
Coordinates | 978434..978853 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | OLD77_RS04575 | Protein ID | WP_061322415.1 |
Coordinates | 978187..978453 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLD77_RS04550 (OLD77_04550) | 973316..973969 | + | 654 | WP_269874922.1 | hypothetical protein | - |
OLD77_RS04555 (OLD77_04555) | 973966..975285 | + | 1320 | WP_015673672.1 | MFS transporter | - |
OLD77_RS04560 (OLD77_04560) | 975317..975925 | - | 609 | WP_061322413.1 | HD domain-containing protein | - |
OLD77_RS04565 (OLD77_04565) | 976120..976800 | + | 681 | WP_015673670.1 | hemolysin III family protein | - |
OLD77_RS04570 (OLD77_04570) | 976855..977847 | - | 993 | WP_015673669.1 | tRNA-modifying protein YgfZ | - |
OLD77_RS04575 (OLD77_04575) | 978187..978453 | + | 267 | WP_061322415.1 | FAD assembly factor SdhE | Antitoxin |
OLD77_RS04580 (OLD77_04580) | 978434..978853 | + | 420 | WP_054306177.1 | protein YgfX | Toxin |
OLD77_RS04585 (OLD77_04585) | 978885..979403 | - | 519 | WP_041411867.1 | flavodoxin FldB | - |
OLD77_RS04590 (OLD77_04590) | 979495..980394 | + | 900 | WP_269874925.1 | site-specific tyrosine recombinase XerD | - |
OLD77_RS04595 (OLD77_04595) | 980422..981138 | + | 717 | WP_015673664.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OLD77_RS04600 (OLD77_04600) | 981151..982881 | + | 1731 | WP_269876071.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16292.19 Da Isoelectric Point: 11.2220
>T263458 WP_054306177.1 NZ_CP110227:978434-978853 [Serratia rubidaea]
VAQWRCDVRISWRTQLVSLLAHGALILLILISPWPESYDPIWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLARRPWMLRGGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRMQLAEDESEG
VAQWRCDVRISWRTQLVSLLAHGALILLILISPWPESYDPIWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLARRPWMLRGGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRMQLAEDESEG
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|