Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 258621..259360 | Replicon | chromosome |
| Accession | NZ_CP110227 | ||
| Organism | Serratia rubidaea strain AO4-P6 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OLD77_RS01185 | Protein ID | WP_061321922.1 |
| Coordinates | 258621..259100 (-) | Length | 160 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L0MKT5 |
| Locus tag | OLD77_RS01190 | Protein ID | WP_015962211.1 |
| Coordinates | 259097..259360 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OLD77_RS01170 (OLD77_01170) | 255734..256207 | - | 474 | WP_015962214.1 | transcription elongation factor GreB | - |
| OLD77_RS01175 (OLD77_01175) | 256498..257217 | + | 720 | WP_004709363.1 | two-component system response regulator OmpR | - |
| OLD77_RS01180 (OLD77_01180) | 257214..258587 | + | 1374 | WP_015962213.1 | two-component system sensor histidine kinase EnvZ | - |
| OLD77_RS01185 (OLD77_01185) | 258621..259100 | - | 480 | WP_061321922.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OLD77_RS01190 (OLD77_01190) | 259097..259360 | - | 264 | WP_015962211.1 | plasmid stability protein | Antitoxin |
| OLD77_RS01195 (OLD77_01195) | 259485..261104 | - | 1620 | WP_061321923.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
| OLD77_RS01200 (OLD77_01200) | 261300..262181 | - | 882 | WP_054305076.1 | Hsp33 family molecular chaperone HslO | - |
| OLD77_RS01205 (OLD77_01205) | 262207..262614 | - | 408 | WP_269874368.1 | ribosome-associated heat shock protein Hsp15 | - |
| OLD77_RS01210 (OLD77_01210) | 262611..263291 | - | 681 | WP_269874369.1 | GMP/IMP nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 17873.48 Da Isoelectric Point: 4.9342
>T263457 WP_061321922.1 NZ_CP110227:c259100-258621 [Serratia rubidaea]
MIILDTNVISETLRPKPHYNVISWLNEKDNSELYLSAIVVAELFSGVACMPDGKRQQALRLRLAEAIQINFDEQILPFDA
LCAMQYAELMGRNQRQGTPMSAPDAQIAATCLQYGATLATRNTKDFLHCGIELIDPWQVPAGQRLHEDAAEYYVMSRKS
MIILDTNVISETLRPKPHYNVISWLNEKDNSELYLSAIVVAELFSGVACMPDGKRQQALRLRLAEAIQINFDEQILPFDA
LCAMQYAELMGRNQRQGTPMSAPDAQIAATCLQYGATLATRNTKDFLHCGIELIDPWQVPAGQRLHEDAAEYYVMSRKS
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|