Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2602805..2603804 | Replicon | chromosome |
Accession | NZ_CP110226 | ||
Organism | Algoriphagus sp. TR-M5 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | OM944_RS10540 | Protein ID | WP_264807560.1 |
Coordinates | 2603241..2603804 (+) | Length | 188 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | - |
Locus tag | OM944_RS10535 | Protein ID | WP_264807559.1 |
Coordinates | 2602805..2603251 (+) | Length | 149 a.a. |
Genomic Context
Location: 2599247..2600842 (1596 bp)
Type: Others
Protein ID: WP_264807557.1
Type: Others
Protein ID: WP_264807557.1
Location: 2600946..2602673 (1728 bp)
Type: Others
Protein ID: WP_264807558.1
Type: Others
Protein ID: WP_264807558.1
Location: 2602805..2603251 (447 bp)
Type: Antitoxin
Protein ID: WP_264807559.1
Type: Antitoxin
Protein ID: WP_264807559.1
Location: 2603241..2603804 (564 bp)
Type: Toxin
Protein ID: WP_264807560.1
Type: Toxin
Protein ID: WP_264807560.1
Location: 2604710..2605858 (1149 bp)
Type: Others
Protein ID: WP_264807562.1
Type: Others
Protein ID: WP_264807562.1
Location: 2598205..2599035 (831 bp)
Type: Others
Protein ID: WP_264807556.1
Type: Others
Protein ID: WP_264807556.1
Location: 2603840..2604640 (801 bp)
Type: Others
Protein ID: WP_264807561.1
Type: Others
Protein ID: WP_264807561.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM944_RS10520 (OM944_10520) | 2598205..2599035 | - | 831 | WP_264807556.1 | universal stress protein | - |
OM944_RS10525 (OM944_10525) | 2599247..2600842 | + | 1596 | WP_264807557.1 | M14 family metallopeptidase | - |
OM944_RS10530 (OM944_10530) | 2600946..2602673 | + | 1728 | WP_264807558.1 | M14 family metallopeptidase | - |
OM944_RS10535 (OM944_10535) | 2602805..2603251 | + | 447 | WP_264807559.1 | helix-turn-helix domain-containing protein | Antitoxin |
OM944_RS10540 (OM944_10540) | 2603241..2603804 | + | 564 | WP_264807560.1 | PIN domain-containing protein | Toxin |
OM944_RS10545 (OM944_10545) | 2603840..2604640 | - | 801 | WP_264807561.1 | LexA family transcriptional regulator | - |
OM944_RS10550 (OM944_10550) | 2604710..2605858 | + | 1149 | WP_264807562.1 | DNA polymerase IV | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2498903..2708841 | 209938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 188 a.a. Molecular weight: 21668.93 Da Isoelectric Point: 5.9262
>T263456 WP_264807560.1 NZ_CP110226:2603241-2603804 [Algoriphagus sp. TR-M5]
MIHSVRFICVLDTNVIYPIDIRDLLFWFAFYDLFTPKWSKHIFDEWLEVMIRKGVKRTEAFKRVSKAHQAFPDALVENYE
PIISSINLPDEKDKHVLAAAIKANANIIVTNNLKDFPPEYLATFGLSVKNADDFITDTIDLNQDLALKAFRTLVMNRQNP
DLNEFEVLDRLRNCGLHDSANYLHSLL
MIHSVRFICVLDTNVIYPIDIRDLLFWFAFYDLFTPKWSKHIFDEWLEVMIRKGVKRTEAFKRVSKAHQAFPDALVENYE
PIISSINLPDEKDKHVLAAAIKANANIIVTNNLKDFPPEYLATFGLSVKNADDFITDTIDLNQDLALKAFRTLVMNRQNP
DLNEFEVLDRLRNCGLHDSANYLHSLL
Download Length: 564 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16946.59 Da Isoelectric Point: 5.7729
>AT263456 WP_264807559.1 NZ_CP110226:2602805-2603251 [Algoriphagus sp. TR-M5]
MEDLIRPTKEDQKAAMKSYDTLASMLKNIHSDYPEIEIEETQERIKIPLNALKLLAEILKETSQGKPVSIVPTATEITTQ
AAAELLGCSRPHLVKLLEQGEINFIKIGKHRRIKYEDVIEYKKKLKAEQRRLLIEIIQSDEESGLYDS
MEDLIRPTKEDQKAAMKSYDTLASMLKNIHSDYPEIEIEETQERIKIPLNALKLLAEILKETSQGKPVSIVPTATEITTQ
AAAELLGCSRPHLVKLLEQGEINFIKIGKHRRIKYEDVIEYKKKLKAEQRRLLIEIIQSDEESGLYDS
Download Length: 447 bp