Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1112703..1113340 | Replicon | chromosome |
Accession | NZ_CP110225 | ||
Organism | Gallibacterium anatis strain IMT49310 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OLL86_RS05145 | Protein ID | WP_264780459.1 |
Coordinates | 1112703..1113110 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OLL86_RS05150 | Protein ID | WP_179255206.1 |
Coordinates | 1113110..1113340 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL86_RS05130 (OLL86_05130) | 1108153..1109271 | - | 1119 | WP_264780457.1 | iron-sulfur cluster carrier protein ApbC | - |
OLL86_RS05135 (OLL86_05135) | 1109469..1111514 | + | 2046 | WP_264780511.1 | methionine--tRNA ligase | - |
OLL86_RS05140 (OLL86_05140) | 1111599..1112603 | + | 1005 | WP_264780458.1 | 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC | - |
OLL86_RS05145 (OLL86_05145) | 1112703..1113110 | - | 408 | WP_264780459.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
OLL86_RS05150 (OLL86_05150) | 1113110..1113340 | - | 231 | WP_179255206.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OLL86_RS05155 (OLL86_05155) | 1113640..1114635 | + | 996 | WP_264780460.1 | thiamine ABC transporter substrate binding subunit | - |
OLL86_RS05160 (OLL86_05160) | 1114611..1116233 | + | 1623 | WP_264780461.1 | thiamine/thiamine pyrophosphate ABC transporter permease | - |
OLL86_RS05165 (OLL86_05165) | 1116220..1116882 | + | 663 | WP_264780462.1 | thiamine ABC transporter ATP-binding protein | - |
OLL86_RS05170 (OLL86_05170) | 1116922..1117932 | + | 1011 | WP_264780463.1 | biotin synthase BioB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15032.60 Da Isoelectric Point: 7.2411
>T263455 WP_264780459.1 NZ_CP110225:c1113110-1112703 [Gallibacterium anatis]
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKMAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIGQPIGPYDAMIAGHARSLGLTVVTNNMNDFSRVEGLRVIDWSKPM
MLKYMLDTNIVIFTIKNKPPHLLPLFNENQSMLCISSITLMELVYGAEKSKKMAQNLAVIESFCARLAVLDYDEAAAYHS
GQIRAELAKIGQPIGPYDAMIAGHARSLGLTVVTNNMNDFSRVEGLRVIDWSKPM
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|