Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1063294..1063839 | Replicon | chromosome |
Accession | NZ_CP110225 | ||
Organism | Gallibacterium anatis strain IMT49310 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F4HF99 |
Locus tag | OLL86_RS04920 | Protein ID | WP_013746939.1 |
Coordinates | 1063294..1063581 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0A2ZZB6 |
Locus tag | OLL86_RS04925 | Protein ID | WP_039087491.1 |
Coordinates | 1063591..1063839 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLL86_RS04890 (OLL86_04890) | 1058568..1059494 | + | 927 | WP_039083772.1 | phosphoserine phosphatase | - |
OLL86_RS04895 (OLL86_04895) | 1059507..1059998 | + | 492 | WP_013746944.1 | YajQ family cyclic di-GMP-binding protein | - |
OLL86_RS04900 (OLL86_04900) | 1060020..1060187 | + | 168 | WP_018345760.1 | DUF5363 family protein | - |
OLL86_RS04905 (OLL86_04905) | 1060272..1062287 | + | 2016 | WP_264780428.1 | NAD-dependent DNA ligase LigA | - |
OLL86_RS04910 (OLL86_04910) | 1062491..1062757 | + | 267 | WP_018345762.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
OLL86_RS04915 (OLL86_04915) | 1062757..1063110 | + | 354 | WP_264780429.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
OLL86_RS04920 (OLL86_04920) | 1063294..1063581 | - | 288 | WP_013746939.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OLL86_RS04925 (OLL86_04925) | 1063591..1063839 | - | 249 | WP_039087491.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OLL86_RS04930 (OLL86_04930) | 1063956..1065008 | - | 1053 | WP_039092160.1 | porin | - |
OLL86_RS04935 (OLL86_04935) | 1065363..1065734 | + | 372 | WP_264780430.1 | hypothetical protein | - |
OLL86_RS04940 (OLL86_04940) | 1066392..1067474 | - | 1083 | WP_264780431.1 | porin | - |
OLL86_RS04945 (OLL86_04945) | 1067730..1068653 | - | 924 | WP_264780432.1 | tRNA pseudouridine(55) synthase TruB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11026.94 Da Isoelectric Point: 10.4262
>T263454 WP_013746939.1 NZ_CP110225:c1063581-1063294 [Gallibacterium anatis]
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
MAYAIKVHSDFVAELNKLDSTIKNQLRKKLEKVVHNPHIPKNRLSGELHNCYKIKLRKAGVRLVYQVNDDEIYILLLTVG
KREAKQVYNTALNRV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | F4HF99 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A2ZZB6 |