Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/COG3657-dnstrm_HI1420
Location 658576..659158 Replicon chromosome
Accession NZ_CP110225
Organism Gallibacterium anatis strain IMT49310

Toxin (Protein)


Gene name PumA Uniprot ID A0A1A7Q827
Locus tag OLL86_RS03005 Protein ID WP_039081967.1
Coordinates 658576..658872 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1A7Q647
Locus tag OLL86_RS03010 Protein ID WP_039081966.1
Coordinates 658874..659158 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OLL86_RS02970 (OLL86_02970) 654384..655574 + 1191 WP_039092605.1 MFS transporter -
OLL86_RS02975 (OLL86_02975) 655661..656266 - 606 WP_264780274.1 hypothetical protein -
OLL86_RS02980 (OLL86_02980) 656325..656477 - 153 Protein_562 integrase core domain-containing protein -
OLL86_RS02985 (OLL86_02985) 656493..657164 - 672 WP_264779844.1 IS3 family transposase -
OLL86_RS02990 (OLL86_02990) 657158..657463 - 306 WP_264779845.1 transposase -
OLL86_RS02995 (OLL86_02995) 657545..657841 + 297 Protein_565 IS3 family transposase -
OLL86_RS03000 (OLL86_03000) 658037..658189 + 153 WP_179256268.1 hypothetical protein -
OLL86_RS03005 (OLL86_03005) 658576..658872 + 297 WP_039081967.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OLL86_RS03010 (OLL86_03010) 658874..659158 + 285 WP_039081966.1 putative addiction module antidote protein Antitoxin
OLL86_RS03015 (OLL86_03015) 659341..660030 - 690 WP_094873999.1 MAE_28990/MAE_18760 family HEPN-like nuclease -
OLL86_RS03020 (OLL86_03020) 660023..661066 - 1044 WP_264780498.1 DUF262 domain-containing protein -
OLL86_RS03025 (OLL86_03025) 661428..662081 + 654 WP_076611454.1 IS1595-like element ISEc69 family transposase -
OLL86_RS03030 (OLL86_03030) 662158..662769 + 612 WP_264780499.1 transposase -
OLL86_RS03035 (OLL86_03035) 662960..663712 - 753 WP_094873995.1 S24 family peptidase -
OLL86_RS03040 (OLL86_03040) 663833..664024 + 192 WP_013747125.1 Cro/CI family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 656493..705246 48753
- inside IScluster/Tn - - 657581..662081 4500


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-90)

Antitoxin

Uncharacterized protein HI1420

(5-91)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 10939.90 Da        Isoelectric Point: 10.5231

>T263453 WP_039081967.1 NZ_CP110225:658576-658872 [Gallibacterium anatis]
MIQIKSTEAFDKWLDNLKDLRARAKIQVRIKRLQLGNFGDVKPIGEGLSELRITEGKGYRLYLKNQNGVIVILLCGGDKS
TQKADIEKAKSLAKILGV

Download         Length: 297 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10521.04 Da        Isoelectric Point: 4.6510

>AT263453 WP_039081966.1 NZ_CP110225:658874-659158 [Gallibacterium anatis]
MAEQLKDFDMSEHLRTEEEIQLYLNEILSEGDIDLLLSALGDIAKARNMSQIAREVGVTREGLYKALSGRGNPTFATVFK
VMQALNLNLEVKHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1A7Q827

Antitoxin

Source ID Structure
AlphaFold DB A0A1A7Q647

References