Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 821660..822308 | Replicon | chromosome |
Accession | NZ_CP110224 | ||
Organism | Virgibacillus natechei strain DSM 25609 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OLD84_RS04560 | Protein ID | WP_209464504.1 |
Coordinates | 821949..822308 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | OLD84_RS04555 | Protein ID | WP_209464503.1 |
Coordinates | 821660..821944 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OLD84_RS04525 (OLD84_04525) | 817098..817457 | + | 360 | WP_209464500.1 | holo-ACP synthase | - |
OLD84_RS04530 (OLD84_04530) | 817516..818154 | + | 639 | WP_264917285.1 | NAD(P)H-hydrate epimerase | - |
OLD84_RS04535 (OLD84_04535) | 818211..818735 | + | 525 | WP_264917286.1 | ADP/ATP-dependent (S)-NAD(P)H-hydrate dehydratase | - |
OLD84_RS04540 (OLD84_04540) | 818834..819118 | + | 285 | WP_264917287.1 | NAD(P)H-hydrate dehydratase | - |
OLD84_RS04545 (OLD84_04545) | 819169..820188 | + | 1020 | WP_209464501.1 | outer membrane lipoprotein carrier protein LolA | - |
OLD84_RS04550 (OLD84_04550) | 820383..821525 | + | 1143 | WP_209464502.1 | alanine racemase | - |
OLD84_RS04555 (OLD84_04555) | 821660..821944 | + | 285 | WP_209464503.1 | antitoxin | Antitoxin |
OLD84_RS04560 (OLD84_04560) | 821949..822308 | + | 360 | WP_209464504.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OLD84_RS04565 (OLD84_04565) | 823099..823968 | + | 870 | WP_209464505.1 | RsbT co-antagonist protein RsbRA | - |
OLD84_RS04570 (OLD84_04570) | 823973..824329 | + | 357 | WP_209464506.1 | STAS domain-containing protein | - |
OLD84_RS04575 (OLD84_04575) | 824332..824733 | + | 402 | WP_209464507.1 | anti-sigma regulatory factor | - |
OLD84_RS04580 (OLD84_04580) | 824827..825837 | + | 1011 | WP_209464508.1 | PP2C family protein-serine/threonine phosphatase | - |
OLD84_RS04585 (OLD84_04585) | 825931..826260 | + | 330 | WP_209464509.1 | STAS domain-containing protein | - |
OLD84_RS04590 (OLD84_04590) | 826260..826733 | + | 474 | WP_209464510.1 | anti-sigma B factor RsbW | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13450.58 Da Isoelectric Point: 6.4723
>T263452 WP_209464504.1 NZ_CP110224:821949-822308 [Virgibacillus natechei]
MIVQRGEVYFADLSPVVGSEQGGIRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDNEMMEKIDQALEISLGLKDMYDH
MIVQRGEVYFADLSPVVGSEQGGIRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDNEMMEKIDQALEISLGLKDMYDH
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|