Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4030870..4031420 Replicon chromosome
Accession NZ_CP110220
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain MFDS1018147

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag OF824_RS19630 Protein ID WP_001199743.1
Coordinates 4030870..4031178 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag OF824_RS19635 Protein ID WP_001118105.1
Coordinates 4031181..4031420 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF824_RS19610 (4027444) 4027444..4028184 - 741 WP_001676217.1 SEF14/SEF18 fimbria chaperone SefB -
OF824_RS19615 (4028306) 4028306..4028836 - 531 WP_001708209.1 SEF14 fimbria major subunit SefA -
OF824_RS19620 (4029159) 4029159..4030292 + 1134 Protein_3834 IS3 family transposase -
OF824_RS19625 (4030324) 4030324..4030464 - 141 Protein_3835 Arm DNA-binding domain-containing protein -
OF824_RS19630 (4030870) 4030870..4031178 - 309 WP_001199743.1 CcdB family protein Toxin
OF824_RS19635 (4031181) 4031181..4031420 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
OF824_RS19640 (4031529) 4031529..4031777 - 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
OF824_RS19645 (4031968) 4031968..4032399 - 432 Protein_3839 helix-turn-helix domain-containing protein -
OF824_RS19655 (4033156) 4033156..4034175 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
OF824_RS19660 (4034203) 4034203..4034733 - 531 WP_000896758.1 gluconokinase -
OF824_RS19665 (4034950) 4034950..4035981 + 1032 WP_000453347.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4029251..4032354 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T263447 WP_001199743.1 NZ_CP110220:c4031178-4030870 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT263447 WP_001118105.1 NZ_CP110220:c4031420-4031181 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References