Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3405067..3405687 | Replicon | chromosome |
| Accession | NZ_CP110220 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain MFDS1018147 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | OF824_RS16755 | Protein ID | WP_001280991.1 |
| Coordinates | 3405469..3405687 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | OF824_RS16750 | Protein ID | WP_000344807.1 |
| Coordinates | 3405067..3405441 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF824_RS16740 (3400206) | 3400206..3401399 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OF824_RS16745 (3401422) | 3401422..3404571 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| OF824_RS16750 (3405067) | 3405067..3405441 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| OF824_RS16755 (3405469) | 3405469..3405687 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| OF824_RS16760 (3405866) | 3405866..3406417 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| OF824_RS16765 (3406535) | 3406535..3407005 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| OF824_RS16770 (3407061) | 3407061..3407201 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| OF824_RS16775 (3407207) | 3407207..3407467 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| OF824_RS16780 (3407692) | 3407692..3409242 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| OF824_RS16790 (3409473) | 3409473..3409862 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| OF824_RS16795 (3409895) | 3409895..3410464 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T263443 WP_001280991.1 NZ_CP110220:3405469-3405687 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT263443 WP_000344807.1 NZ_CP110220:3405067-3405441 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|