Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 1775594..1776042 | Replicon | chromosome |
| Accession | NZ_CP110217 | ||
| Organism | Lactobacillus sp. IBH004 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LDX54_RS08810 | Protein ID | WP_265667387.1 |
| Coordinates | 1775710..1776042 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | LDX54_RS08805 | Protein ID | WP_265667389.1 |
| Coordinates | 1775594..1775716 (+) | Length | 41 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LDX54_RS08790 (LDX54_02640) | 1771420..1772763 | - | 1344 | WP_265667392.1 | 6-phospho-alpha-glucosidase | - |
| LDX54_RS08795 (LDX54_02635) | 1772998..1773927 | - | 930 | WP_265667391.1 | cytochrome C5 | - |
| LDX54_RS08800 (LDX54_02630) | 1774079..1775317 | + | 1239 | WP_265667390.1 | MFS transporter | - |
| LDX54_RS08805 (LDX54_02625) | 1775594..1775716 | + | 123 | WP_265667389.1 | hypothetical protein | Antitoxin |
| LDX54_RS08810 (LDX54_02620) | 1775710..1776042 | + | 333 | WP_265667387.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LDX54_RS08815 (LDX54_02615) | 1776616..1777860 | - | 1245 | WP_265667386.1 | MFS transporter | - |
| LDX54_RS08820 (LDX54_02610) | 1777966..1778823 | + | 858 | WP_265667385.1 | hypothetical protein | - |
| LDX54_RS08825 (LDX54_02605) | 1779025..1779660 | + | 636 | WP_265667384.1 | hypothetical protein | - |
| LDX54_RS08830 (LDX54_02600) | 1780174..1780641 | - | 468 | WP_265667383.1 | PBECR4 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12665.80 Da Isoelectric Point: 9.6357
>T263431 WP_265667387.1 NZ_CP110217:1775710-1776042 [Lactobacillus sp. IBH004]
MVIKQGSILLMDLSPKQGHEQSGKRPYLYLSYKGVEKYAHIAVFAPIATTKRRYPLYQELPAASQTKGVVMLDQLVTIDY
HNQSFQYLEQLPDDYMGKILKIVKVVFQKD
MVIKQGSILLMDLSPKQGHEQSGKRPYLYLSYKGVEKYAHIAVFAPIATTKRRYPLYQELPAASQTKGVVMLDQLVTIDY
HNQSFQYLEQLPDDYMGKILKIVKVVFQKD
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|