Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3494198..3494818 | Replicon | chromosome |
| Accession | NZ_CP110201 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-65 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | OCK73_RS17210 | Protein ID | WP_001280991.1 |
| Coordinates | 3494600..3494818 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | OCK73_RS17205 | Protein ID | WP_000344807.1 |
| Coordinates | 3494198..3494572 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCK73_RS17195 (3489337) | 3489337..3490530 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| OCK73_RS17200 (3490553) | 3490553..3493702 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| OCK73_RS17205 (3494198) | 3494198..3494572 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| OCK73_RS17210 (3494600) | 3494600..3494818 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| OCK73_RS17215 (3494997) | 3494997..3495548 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| OCK73_RS17220 (3495665) | 3495665..3496135 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| OCK73_RS17225 (3496191) | 3496191..3496331 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| OCK73_RS17230 (3496337) | 3496337..3496597 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| OCK73_RS17235 (3496822) | 3496822..3498372 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| OCK73_RS17245 (3498603) | 3498603..3498992 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| OCK73_RS17250 (3499025) | 3499025..3499594 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T263421 WP_001280991.1 NZ_CP110201:3494600-3494818 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT263421 WP_000344807.1 NZ_CP110201:3494198-3494572 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|