Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4417067..4417848 | Replicon | chromosome |
Accession | NZ_CP110198 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-75 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | OCK70_RS21575 | Protein ID | WP_000626099.1 |
Coordinates | 4417067..4417558 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | OCK70_RS21580 | Protein ID | WP_001110452.1 |
Coordinates | 4417555..4417848 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCK70_RS21535 (4412253) | 4412253..4412495 | - | 243 | WP_197603740.1 | hypothetical protein | - |
OCK70_RS21540 (4412492) | 4412492..4412848 | - | 357 | WP_033567083.1 | hypothetical protein | - |
OCK70_RS21545 (4412845) | 4412845..4413717 | - | 873 | WP_033567082.1 | ParA family protein | - |
OCK70_RS21550 (4413908) | 4413908..4413985 | - | 78 | Protein_4215 | helix-turn-helix domain-containing protein | - |
OCK70_RS21555 (4414076) | 4414076..4414408 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
OCK70_RS21560 (4414480) | 4414480..4414857 | + | 378 | WP_000916345.1 | EthD family reductase | - |
OCK70_RS21565 (4415890) | 4415890..4415964 | + | 75 | Protein_4218 | porin family protein | - |
OCK70_RS21570 (4416067) | 4416067..4416819 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
OCK70_RS21575 (4417067) | 4417067..4417558 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
OCK70_RS21580 (4417555) | 4417555..4417848 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
OCK70_RS21585 (4418165) | 4418165..4418386 | + | 222 | WP_001576552.1 | hypothetical protein | - |
OCK70_RS21590 (4418651) | 4418651..4419526 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
OCK70_RS21595 (4419523) | 4419523..4419810 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
OCK70_RS21600 (4419833) | 4419833..4420048 | + | 216 | WP_001595136.1 | hypothetical protein | - |
OCK70_RS21605 (4420056) | 4420056..4420325 | + | 270 | WP_010989096.1 | hypothetical protein | - |
OCK70_RS21610 (4420619) | 4420619..4421524 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T263405 WP_000626099.1 NZ_CP110198:c4417558-4417067 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT263405 WP_001110452.1 NZ_CP110198:c4417848-4417555 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |