Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3493814..3494434 | Replicon | chromosome |
Accession | NZ_CP110198 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-75 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | OCK70_RS17195 | Protein ID | WP_001280991.1 |
Coordinates | 3494216..3494434 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | OCK70_RS17190 | Protein ID | WP_000344807.1 |
Coordinates | 3493814..3494188 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCK70_RS17180 (3488953) | 3488953..3490146 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OCK70_RS17185 (3490169) | 3490169..3493318 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
OCK70_RS17190 (3493814) | 3493814..3494188 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
OCK70_RS17195 (3494216) | 3494216..3494434 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
OCK70_RS17200 (3494613) | 3494613..3495164 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
OCK70_RS17205 (3495281) | 3495281..3495751 | + | 471 | WP_000136181.1 | YlaC family protein | - |
OCK70_RS17210 (3495807) | 3495807..3495947 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
OCK70_RS17215 (3495953) | 3495953..3496213 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
OCK70_RS17220 (3496438) | 3496438..3497988 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
OCK70_RS17230 (3498219) | 3498219..3498608 | + | 390 | WP_000961285.1 | MGMT family protein | - |
OCK70_RS17235 (3498641) | 3498641..3499210 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T263400 WP_001280991.1 NZ_CP110198:3494216-3494434 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT263400 WP_000344807.1 NZ_CP110198:3493814-3494188 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|