Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 37162..37709 Replicon plasmid p3FK563
Accession NZ_CP110196
Organism Klebsiella pneumoniae strain FK563

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag OEW01_RS27775 Protein ID WP_244449344.1
Coordinates 37431..37709 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E2GHF7
Locus tag OEW01_RS27770 Protein ID WP_012881119.1
Coordinates 37162..37431 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEW01_RS27735 (32791) 32791..33003 + 213 WP_001309245.1 ANR family transcriptional regulator -
OEW01_RS27740 (33248) 33248..33709 + 462 WP_001233838.1 thermonuclease family protein -
OEW01_RS27745 (33755) 33755..33964 + 210 WP_001298565.1 hemolysin expression modulator Hha -
OEW01_RS27750 (34002) 34002..34592 + 591 WP_000766807.1 DUF2726 domain-containing protein -
OEW01_RS27755 (34832) 34832..35086 + 255 WP_000083830.1 replication regulatory protein RepA -
OEW01_RS27760 (35324) 35324..35398 + 75 WP_001365705.1 RepA leader peptide Tap -
OEW01_RS27765 (35391) 35391..36248 + 858 WP_000130646.1 incFII family plasmid replication initiator RepA -
OEW01_RS27770 (37162) 37162..37431 + 270 WP_012881119.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
OEW01_RS27775 (37431) 37431..37709 + 279 WP_244449344.1 type II toxin-antitoxin system toxin YacB Toxin
OEW01_RS27780 (37755) 37755..38603 + 849 WP_012881117.1 3'-5' exonuclease -
OEW01_RS27785 (38720) 38720..39202 + 483 WP_001311056.1 hypothetical protein -
OEW01_RS27790 (39231) 39231..40307 - 1077 WP_077252865.1 maltoporin -
OEW01_RS27795 (40308) 40308..40760 - 453 Protein_47 IS5 family transposase -
OEW01_RS27800 (40795) 40795..41670 - 876 WP_001617865.1 extended-spectrum class A beta-lactamase CTX-M-14 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-14 - 1..70069 70069
- flank IS/Tn blaCTX-M-14 - 40795..43182 2387


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10744.34 Da        Isoelectric Point: 8.4615

>T263388 WP_244449344.1 NZ_CP110196:37431-37709 [Klebsiella pneumoniae]
MEIFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10206.54 Da        Isoelectric Point: 8.8735

>AT263388 WP_012881119.1 NZ_CP110196:37162-37431 [Klebsiella pneumoniae]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSATAWRD
EISRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y1YSD8

References