Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 41236..41761 | Replicon | plasmid p2FK563 |
| Accession | NZ_CP110195 | ||
| Organism | Klebsiella pneumoniae strain FK563 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | OEW01_RS27180 | Protein ID | WP_013023785.1 |
| Coordinates | 41456..41761 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | OEW01_RS27175 | Protein ID | WP_001568025.1 |
| Coordinates | 41236..41454 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEW01_RS27155 (OEW01_27155) | 36392..37171 | + | 780 | WP_013023780.1 | hypothetical protein | - |
| OEW01_RS27160 (OEW01_27160) | 37447..38970 | + | 1524 | WP_017899887.1 | hypothetical protein | - |
| OEW01_RS27165 (OEW01_27165) | 39004..40131 | + | 1128 | WP_013023782.1 | DUF4238 domain-containing protein | - |
| OEW01_RS27170 (OEW01_27170) | 40128..40418 | + | 291 | WP_013023783.1 | hypothetical protein | - |
| OEW01_RS27175 (OEW01_27175) | 41236..41454 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| OEW01_RS27180 (OEW01_27180) | 41456..41761 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| OEW01_RS27185 (OEW01_27185) | 41930..42325 | + | 396 | WP_017899885.1 | hypothetical protein | - |
| OEW01_RS27190 (OEW01_27190) | 42352..42666 | + | 315 | WP_053389906.1 | hypothetical protein | - |
| OEW01_RS27195 (OEW01_27195) | 42677..43693 | + | 1017 | WP_017899884.1 | hypothetical protein | - |
| OEW01_RS27200 (OEW01_27200) | 43891..44685 | + | 795 | WP_004197635.1 | site-specific integrase | - |
| OEW01_RS27205 (OEW01_27205) | 45117..45419 | - | 303 | WP_004197636.1 | hypothetical protein | - |
| OEW01_RS27210 (OEW01_27210) | 45416..46042 | - | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..94216 | 94216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T263387 WP_013023785.1 NZ_CP110195:41456-41761 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |