Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 96022..96547 | Replicon | plasmid p1FK563 |
| Accession | NZ_CP110194 | ||
| Organism | Klebsiella pneumoniae strain FK563 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | OEW01_RS26605 | Protein ID | WP_001159868.1 |
| Coordinates | 96242..96547 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | OEW01_RS26600 | Protein ID | WP_000813634.1 |
| Coordinates | 96022..96240 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEW01_RS26585 (92549) | 92549..93246 | + | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| OEW01_RS26590 (93383) | 93383..94315 | - | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
| OEW01_RS26595 (94319) | 94319..95314 | - | 996 | WP_000246636.1 | hypothetical protein | - |
| OEW01_RS26600 (96022) | 96022..96240 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| OEW01_RS26605 (96242) | 96242..96547 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| OEW01_RS26610 (96548) | 96548..97354 | + | 807 | WP_000016982.1 | site-specific integrase | - |
| OEW01_RS26615 (98128) | 98128..98883 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| OEW01_RS26620 (99471) | 99471..100637 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..154204 | 154204 | |
| - | flank | IS/Tn | - | - | 92743..93246 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T263383 WP_001159868.1 NZ_CP110194:96242-96547 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|