Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 85489..86090 | Replicon | plasmid p1FK563 |
| Accession | NZ_CP110194 | ||
| Organism | Klebsiella pneumoniae strain FK563 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | OEW01_RS26560 | Protein ID | WP_001216034.1 |
| Coordinates | 85489..85869 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | OEW01_RS26565 | Protein ID | WP_001190712.1 |
| Coordinates | 85869..86090 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEW01_RS26525 (80540) | 80540..81472 | - | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
| OEW01_RS26530 (81459) | 81459..82862 | - | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| OEW01_RS26535 (83106) | 83106..84086 | + | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
| OEW01_RS26540 (84296) | 84296..84631 | + | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| OEW01_RS26545 (84581) | 84581..84994 | - | 414 | Protein_103 | integrase core domain-containing protein | - |
| OEW01_RS26550 (84999) | 84999..85277 | - | 279 | Protein_104 | pdcB | - |
| OEW01_RS26555 (85305) | 85305..85484 | - | 180 | WP_001513661.1 | hypothetical protein | - |
| OEW01_RS26560 (85489) | 85489..85869 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| OEW01_RS26565 (85869) | 85869..86090 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OEW01_RS26570 (86273) | 86273..87829 | + | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| OEW01_RS26575 (87826) | 87826..89097 | + | 1272 | WP_023142242.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 | senB | 1..154204 | 154204 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T263382 WP_001216034.1 NZ_CP110194:c85869-85489 [Klebsiella pneumoniae]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |