Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 85489..86090 Replicon plasmid p1FK563
Accession NZ_CP110194
Organism Klebsiella pneumoniae strain FK563

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag OEW01_RS26560 Protein ID WP_001216034.1
Coordinates 85489..85869 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag OEW01_RS26565 Protein ID WP_001190712.1
Coordinates 85869..86090 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEW01_RS26525 (80540) 80540..81472 - 933 WP_000081352.1 homocysteine S-methyltransferase -
OEW01_RS26530 (81459) 81459..82862 - 1404 WP_001373486.1 S-methylmethionine permease -
OEW01_RS26535 (83106) 83106..84086 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
OEW01_RS26540 (84296) 84296..84631 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
OEW01_RS26545 (84581) 84581..84994 - 414 Protein_103 integrase core domain-containing protein -
OEW01_RS26550 (84999) 84999..85277 - 279 Protein_104 pdcB -
OEW01_RS26555 (85305) 85305..85484 - 180 WP_001513661.1 hypothetical protein -
OEW01_RS26560 (85489) 85489..85869 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OEW01_RS26565 (85869) 85869..86090 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OEW01_RS26570 (86273) 86273..87829 + 1557 WP_001617892.1 type I restriction-modification system subunit M -
OEW01_RS26575 (87826) 87826..89097 + 1272 WP_023142242.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aac(3)-IId / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / dfrA17 senB 1..154204 154204


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T263382 WP_001216034.1 NZ_CP110194:c85869-85489 [Klebsiella pneumoniae]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT263382 WP_001190712.1 NZ_CP110194:c86090-85869 [Klebsiella pneumoniae]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References