Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4675509..4676319 | Replicon | chromosome |
Accession | NZ_CP110193 | ||
Organism | Klebsiella pneumoniae strain FK563 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A483G813 |
Locus tag | OEW01_RS22830 | Protein ID | WP_023279404.1 |
Coordinates | 4675509..4676042 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | OEW01_RS22835 | Protein ID | WP_002887278.1 |
Coordinates | 4676053..4676319 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEW01_RS22825 (4674340) | 4674340..4675461 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
OEW01_RS22830 (4675509) | 4675509..4676042 | - | 534 | WP_023279404.1 | type II toxin-antitoxin system toxin KacT | Toxin |
OEW01_RS22835 (4676053) | 4676053..4676319 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
OEW01_RS22840 (4676422) | 4676422..4677855 | - | 1434 | WP_004192214.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
OEW01_RS22845 (4677845) | 4677845..4678528 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
OEW01_RS22850 (4678700) | 4678700..4680085 | + | 1386 | WP_004192218.1 | efflux transporter outer membrane subunit | - |
OEW01_RS22855 (4680103) | 4680103..4680447 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19809.71 Da Isoelectric Point: 6.2369
>T263375 WP_023279404.1 NZ_CP110193:c4676042-4675509 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483G813 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |