Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4073732..4074351 Replicon chromosome
Accession NZ_CP110193
Organism Klebsiella pneumoniae strain FK563

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OEW01_RS19950 Protein ID WP_002892050.1
Coordinates 4074133..4074351 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OEW01_RS19945 Protein ID WP_002892066.1
Coordinates 4073732..4074106 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEW01_RS19935 (4068884) 4068884..4070077 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OEW01_RS19940 (4070100) 4070100..4073246 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OEW01_RS19945 (4073732) 4073732..4074106 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OEW01_RS19950 (4074133) 4074133..4074351 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OEW01_RS19955 (4074510) 4074510..4075076 + 567 WP_002892030.1 maltose O-acetyltransferase -
OEW01_RS19960 (4075048) 4075048..4075188 - 141 WP_004147370.1 hypothetical protein -
OEW01_RS19965 (4075209) 4075209..4075679 + 471 WP_002892026.1 YlaC family protein -
OEW01_RS19970 (4075654) 4075654..4077105 - 1452 WP_021313732.1 PLP-dependent aminotransferase family protein -
OEW01_RS19975 (4077206) 4077206..4077904 + 699 WP_002892021.1 GNAT family protein -
OEW01_RS19980 (4077901) 4077901..4078041 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OEW01_RS19985 (4078041) 4078041..4078304 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T263374 WP_002892050.1 NZ_CP110193:4074133-4074351 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT263374 WP_002892066.1 NZ_CP110193:4073732-4074106 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References