Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 117050..117743 | Replicon | plasmid unnamed1 |
Accession | NZ_CP110191 | ||
Organism | Pseudomonas aeruginosa strain HS204 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | OMP51_RS32990 | Protein ID | WP_003151133.1 |
Coordinates | 117366..117743 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | OMP51_RS32985 | Protein ID | WP_001172026.1 |
Coordinates | 117050..117385 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMP51_RS32950 (OMP51_32935) | 112222..113520 | + | 1299 | WP_258154055.1 | hypothetical protein | - |
OMP51_RS32955 (OMP51_32940) | 113583..113837 | - | 255 | WP_010792929.1 | hypothetical protein | - |
OMP51_RS32960 (OMP51_32945) | 114214..114573 | + | 360 | WP_010792928.1 | DUF805 domain-containing protein | - |
OMP51_RS32965 (OMP51_32950) | 115408..115896 | + | 489 | WP_038405174.1 | hypothetical protein | - |
OMP51_RS32970 (OMP51_32955) | 115993..116334 | - | 342 | WP_025999701.1 | hypothetical protein | - |
OMP51_RS32975 (OMP51_32960) | 116350..116676 | - | 327 | WP_000091614.1 | hypothetical protein | - |
OMP51_RS32980 (OMP51_32965) | 116700..117035 | - | 336 | WP_000741275.1 | hypothetical protein | - |
OMP51_RS32985 (OMP51_32970) | 117050..117385 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OMP51_RS32990 (OMP51_32975) | 117366..117743 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMP51_RS32995 (OMP51_32980) | 117935..118537 | + | 603 | WP_010465829.1 | recombinase family protein | - |
OMP51_RS33000 (OMP51_32985) | 118521..121550 | + | 3030 | WP_010799689.1 | Tn3 family transposase | - |
OMP51_RS33005 (OMP51_32990) | 121645..122418 | + | 774 | WP_258153958.1 | 3'-5' exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sul1 / blaPER-1 / qnrVC6 / qacE | - | 1..416612 | 416612 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T263363 WP_003151133.1 NZ_CP110191:c117743-117366 [Pseudomonas aeruginosa]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |