Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5545382..5545968 | Replicon | chromosome |
Accession | NZ_CP110190 | ||
Organism | Pseudomonas aeruginosa strain HS204 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | OMP51_RS26250 | Protein ID | WP_003120987.1 |
Coordinates | 5545669..5545968 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OMP51_RS26245 | Protein ID | WP_003448662.1 |
Coordinates | 5545382..5545672 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMP51_RS26225 (OMP51_26210) | 5541204..5543180 | + | 1977 | WP_010792226.1 | DEAD/DEAH box helicase | - |
OMP51_RS26230 (OMP51_26215) | 5543190..5543324 | + | 135 | WP_033179080.1 | hypothetical protein | - |
OMP51_RS26235 (OMP51_26220) | 5543321..5543614 | + | 294 | WP_049881459.1 | hypothetical protein | - |
OMP51_RS26240 (OMP51_26225) | 5543696..5544967 | + | 1272 | WP_023082545.1 | IS4-like element ISPa1635 family transposase | - |
OMP51_RS26245 (OMP51_26230) | 5545382..5545672 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
OMP51_RS26250 (OMP51_26235) | 5545669..5545968 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMP51_RS26255 (OMP51_26240) | 5546170..5547291 | + | 1122 | WP_003448658.1 | TcpQ domain-containing protein | - |
OMP51_RS26260 (OMP51_26245) | 5547291..5549000 | + | 1710 | WP_010792227.1 | PilN family type IVB pilus formation outer membrane protein | - |
OMP51_RS26265 (OMP51_26250) | 5549004..5550329 | + | 1326 | WP_003120992.1 | type 4b pilus protein PilO2 | - |
OMP51_RS26270 (OMP51_26255) | 5550319..5550852 | + | 534 | WP_003120993.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5513400..5602431 | 89031 | |
- | flank | IS/Tn | - | - | 5543696..5544967 | 1271 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T263360 WP_003120987.1 NZ_CP110190:c5545968-5545669 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|