Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5453851..5454437 | Replicon | chromosome |
Accession | NZ_CP110190 | ||
Organism | Pseudomonas aeruginosa strain HS204 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | OMP51_RS25745 | Protein ID | WP_003120987.1 |
Coordinates | 5454138..5454437 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OMP51_RS25740 | Protein ID | WP_003448662.1 |
Coordinates | 5453851..5454141 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMP51_RS25720 (OMP51_25705) | 5449433..5451322 | + | 1890 | WP_196994395.1 | hypothetical protein | - |
OMP51_RS25725 (OMP51_25710) | 5451319..5453295 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
OMP51_RS25730 (OMP51_25715) | 5453305..5453439 | + | 135 | WP_255253641.1 | hypothetical protein | - |
OMP51_RS25735 (OMP51_25720) | 5453436..5453780 | + | 345 | WP_016851612.1 | hypothetical protein | - |
OMP51_RS25740 (OMP51_25725) | 5453851..5454141 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
OMP51_RS25745 (OMP51_25730) | 5454138..5454437 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMP51_RS25750 (OMP51_25735) | 5454639..5455763 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
OMP51_RS25755 (OMP51_25740) | 5455763..5457472 | + | 1710 | WP_003099757.1 | PilN family type IVB pilus formation outer membrane protein | - |
OMP51_RS25760 (OMP51_25745) | 5457476..5458801 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
OMP51_RS25765 (OMP51_25750) | 5458791..5459324 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T263359 WP_003120987.1 NZ_CP110190:c5454437-5454138 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|