Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5039811..5040419 | Replicon | chromosome |
Accession | NZ_CP110190 | ||
Organism | Pseudomonas aeruginosa strain HS204 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | OMP51_RS23840 | Protein ID | WP_019486378.1 |
Coordinates | 5039811..5040158 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | OMP51_RS23845 | Protein ID | WP_003114155.1 |
Coordinates | 5040168..5040419 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OMP51_RS23815 (OMP51_23800) | 5036038..5036361 | + | 324 | WP_032958199.1 | helix-turn-helix domain-containing protein | - |
OMP51_RS23820 (OMP51_23805) | 5036366..5036863 | + | 498 | WP_041104366.1 | arsenate reductase ArsC | - |
OMP51_RS23825 (OMP51_23810) | 5036871..5037956 | + | 1086 | WP_280156736.1 | ACR3 family arsenite efflux transporter | - |
OMP51_RS23830 (OMP51_23815) | 5037970..5038392 | + | 423 | WP_280156737.1 | arsenate reductase (glutaredoxin) | - |
OMP51_RS23835 (OMP51_23820) | 5038385..5039107 | + | 723 | WP_032958192.1 | arsenical resistance protein ArsH | - |
OMP51_RS23840 (OMP51_23825) | 5039811..5040158 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OMP51_RS23845 (OMP51_23830) | 5040168..5040419 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OMP51_RS23850 (OMP51_23835) | 5040633..5041616 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
OMP51_RS23855 (OMP51_23840) | 5041616..5042908 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
OMP51_RS23860 (OMP51_23845) | 5043138..5044412 | - | 1275 | WP_179063290.1 | zonular occludens toxin family protein | - |
OMP51_RS23865 (OMP51_23850) | 5044416..5044772 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4890871..5051711 | 160840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T263358 WP_019486378.1 NZ_CP110190:c5040158-5039811 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |