Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 149449..149954 | Replicon | chromosome |
| Accession | NZ_CP110190 | ||
| Organism | Pseudomonas aeruginosa strain HS204 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | OMP51_RS00680 | Protein ID | WP_003083773.1 |
| Coordinates | 149449..149730 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | OMP51_RS00685 | Protein ID | WP_003083775.1 |
| Coordinates | 149727..149954 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OMP51_RS00655 (OMP51_00655) | 144700..146049 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| OMP51_RS00660 (OMP51_00660) | 146098..146784 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| OMP51_RS00665 (OMP51_00665) | 146885..147619 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
| OMP51_RS00670 (OMP51_00670) | 147799..148209 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
| OMP51_RS00675 (OMP51_00675) | 148241..149149 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| OMP51_RS00680 (OMP51_00680) | 149449..149730 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| OMP51_RS00685 (OMP51_00685) | 149727..149954 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OMP51_RS00690 (OMP51_00690) | 150130..150750 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| OMP51_RS00695 (OMP51_00695) | 150851..151351 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
| OMP51_RS00700 (OMP51_00700) | 151424..151765 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| OMP51_RS00705 (OMP51_00705) | 151847..153274 | - | 1428 | WP_003083784.1 | GABA permease | - |
| OMP51_RS00710 (OMP51_00710) | 153443..154936 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T263354 WP_003083773.1 NZ_CP110190:c149730-149449 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|