Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1053440..1053968 Replicon chromosome
Accession NZ_CP110189
Organism Vibrio cholerae strain E1

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag OFY13_RS18335 Protein ID WP_000221354.1
Coordinates 1053440..1053727 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0X1KZS8
Locus tag OFY13_RS18340 Protein ID WP_001250179.1
Coordinates 1053717..1053968 (-) Length 84 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OFY13_RS18290 (OFY13_18290) 1048938..1049000 - 63 Protein_938 DUF645 family protein -
OFY13_RS18295 (OFY13_18295) 1049362..1049757 - 396 WP_000870864.1 DUF3465 domain-containing protein -
OFY13_RS18300 (OFY13_18300) 1049973..1050126 - 154 Protein_940 DUF645 family protein -
OFY13_RS18305 (OFY13_18305) 1050187..1050363 - 177 WP_080003854.1 acetyltransferase -
OFY13_RS18310 (OFY13_18310) 1050479..1050660 - 182 Protein_942 DUF645 family protein -
OFY13_RS18315 (OFY13_18315) 1051013..1051192 - 180 WP_025998961.1 DUF645 family protein -
OFY13_RS18320 (OFY13_18320) 1051489..1052070 - 582 WP_043990376.1 nucleotidyltransferase family protein -
OFY13_RS18325 (OFY13_18325) 1052220..1052324 - 105 WP_228840819.1 DUF645 family protein -
OFY13_RS18330 (OFY13_18330) 1052695..1053294 - 600 WP_057558148.1 glutathione S-transferase N-terminal domain-containing protein -
OFY13_RS18335 (OFY13_18335) 1053440..1053727 - 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OFY13_RS18340 (OFY13_18340) 1053717..1053968 - 252 WP_001250179.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OFY13_RS18345 (OFY13_18345) 1054172..1054711 - 540 WP_001898634.1 histidine phosphatase family protein -
OFY13_RS18350 (OFY13_18350) 1054864..1055361 - 498 WP_000259905.1 GNAT family N-acetyltransferase -
OFY13_RS18355 (OFY13_18355) 1055537..1055794 - 258 WP_001893682.1 hypothetical protein -
OFY13_RS18360 (OFY13_18360) 1055878..1055988 - 111 WP_080003855.1 DUF3265 domain-containing protein -
OFY13_RS18365 (OFY13_18365) 1055991..1056632 - 642 WP_000582578.1 hypothetical protein -
OFY13_RS18370 (OFY13_18370) 1056769..1057257 - 489 WP_000424242.1 hypothetical protein -
OFY13_RS18375 (OFY13_18375) 1057507..1057728 - 222 WP_041163199.1 DUF1289 domain-containing protein -
OFY13_RS18380 (OFY13_18380) 1057748..1057909 - 162 WP_080385993.1 DUF3265 domain-containing protein -
OFY13_RS18385 (OFY13_18385) 1058332..1058727 - 396 WP_001000868.1 hypothetical protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron - hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA 44..1062811 1062767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T263353 WP_000221354.1 NZ_CP110189:c1053727-1053440 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp


Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9136.29 Da        Isoelectric Point: 4.0197

>AT263353 WP_001250179.1 NZ_CP110189:c1053968-1053717 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLAQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6


Antitoxin

Source ID Structure
AlphaFold DB A0A0X1KZS8

References