Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 1036227..1036774 Replicon chromosome
Accession NZ_CP110189
Organism Vibrio cholerae strain E1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OFY13_RS18175 Protein ID WP_131476981.1
Coordinates 1036227..1036529 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag OFY13_RS18180 Protein ID WP_000861987.1
Coordinates 1036517..1036774 (-) Length 86 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OFY13_RS18125 (OFY13_18125) 1031251..1031421 - 171 WP_001080654.1 hypothetical protein -
OFY13_RS18130 (OFY13_18130) 1031503..1031940 - 438 WP_000503164.1 IS200/IS605-like element IS1004 family transposase -
OFY13_RS18135 (OFY13_18135) 1031984..1032247 - 264 Protein_907 GNAT family N-acetyltransferase -
OFY13_RS18140 (OFY13_18140) 1032318..1033507 + 1190 WP_088124793.1 IS3 family transposase -
OFY13_RS18145 (OFY13_18145) 1033517..1033840 - 324 Protein_909 GNAT family N-acetyltransferase -
OFY13_RS18150 (OFY13_18150) 1033977..1034637 - 661 Protein_910 Vat family streptogramin A O-acetyltransferase -
OFY13_RS18155 (OFY13_18155) 1034755..1035060 - 306 WP_000063756.1 hypothetical protein -
OFY13_RS18160 (OFY13_18160) 1035179..1035526 - 348 WP_000933406.1 hypothetical protein -
OFY13_RS18165 (OFY13_18165) 1035734..1035904 - 171 WP_000483444.1 DUF645 family protein -
OFY13_RS18170 (OFY13_18170) 1035990..1036148 - 159 Protein_914 acetyltransferase -
OFY13_RS18175 (OFY13_18175) 1036227..1036529 - 303 WP_131476981.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OFY13_RS18180 (OFY13_18180) 1036517..1036774 - 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OFY13_RS18185 (OFY13_18185) 1037025..1037204 - 180 WP_025998961.1 DUF645 family protein -
OFY13_RS18190 (OFY13_18190) 1037375..1037443 - 69 Protein_918 acetyltransferase -
OFY13_RS18195 (OFY13_18195) 1037499..1037996 - 498 WP_000259905.1 GNAT family N-acetyltransferase -
OFY13_RS18200 (OFY13_18200) 1038194..1038619 - 426 WP_000415750.1 hypothetical protein -
OFY13_RS18205 (OFY13_18205) 1038904..1039452 - 549 WP_000059064.1 hypothetical protein -
OFY13_RS18210 (OFY13_18210) 1039593..1040132 - 540 WP_001898634.1 histidine phosphatase family protein -
OFY13_RS18215 (OFY13_18215) 1040164..1040229 - 66 Protein_923 acetyltransferase -
OFY13_RS18220 (OFY13_18220) 1040304..1040600 - 297 WP_000617997.1 Dabb family protein -
OFY13_RS18225 (OFY13_18225) 1040740..1041285 - 546 WP_000494513.1 GNAT family protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1003220..1033507 30287
- inside Integron - hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA 44..1062811 1062767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 101 a.a.        Molecular weight: 11739.64 Da        Isoelectric Point: 4.8838

>T263352 WP_131476981.1 NZ_CP110189:c1036529-1036227 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNLCRVFYKYDDANV
RILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp


Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT263352 WP_000861987.1 NZ_CP110189:c1036774-1036517 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References