263350

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 1028370..1029136 Replicon chromosome
Accession NZ_CP110189
Organism Vibrio cholerae strain E1

Toxin (Protein)


Gene name - Uniprot ID Q9K2P7
Locus tag OFY13_RS18090 Protein ID WP_000982260.1
Coordinates 1028639..1029136 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9K2J6
Locus tag OFY13_RS18085 Protein ID WP_000246253.1
Coordinates 1028370..1028642 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OFY13_RS18020 (OFY13_18020) 1023450..1023560 - 111 WP_100245224.1 DUF3265 domain-containing protein -
OFY13_RS18025 (OFY13_18025) 1023570..1024103 - 534 WP_000118351.1 GNAT family N-acetyltransferase -
OFY13_RS18030 (OFY13_18030) 1024100..1024369 - 270 WP_000179600.1 DUF1778 domain-containing protein -
OFY13_RS18035 (OFY13_18035) 1024592..1024963 - 372 WP_001164078.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
OFY13_RS18040 (OFY13_18040) 1025211..1025471 - 261 WP_032468027.1 DUF3709 domain-containing protein -
OFY13_RS18045 (OFY13_18045) 1025496..1025620 - 125 Protein_889 hypothetical protein -
OFY13_RS18050 (OFY13_18050) 1025630..1025746 - 117 WP_088124786.1 DUF3265 domain-containing protein -
OFY13_RS18055 (OFY13_18055) 1025743..1026360 - 618 WP_000695406.1 hypothetical protein -
OFY13_RS18060 (OFY13_18060) 1026562..1026688 - 127 Protein_892 DUF645 family protein -
OFY13_RS18065 (OFY13_18065) 1026685..1026810 - 126 WP_080388997.1 general secretion pathway protein GspH -
OFY13_RS18070 (OFY13_18070) 1027032..1027319 - 288 WP_000426470.1 hypothetical protein -
OFY13_RS18075 (OFY13_18075) 1027471..1028139 - 669 WP_000043871.1 hypothetical protein -
OFY13_RS18080 (OFY13_18080) 1028156..1028218 - 63 Protein_896 acetyltransferase -
OFY13_RS18085 (OFY13_18085) 1028370..1028642 + 273 WP_000246253.1 DUF1778 domain-containing protein Antitoxin
OFY13_RS18090 (OFY13_18090) 1028639..1029136 + 498 WP_000982260.1 GNAT family N-acetyltransferase Toxin
OFY13_RS18095 (OFY13_18095) 1029338..1029442 - 105 WP_228840819.1 DUF645 family protein -
OFY13_RS18100 (OFY13_18100) 1029633..1029755 - 123 Protein_900 acetyltransferase -
OFY13_RS18105 (OFY13_18105) 1029812..1030267 - 456 WP_133320143.1 GNAT family N-acetyltransferase -
OFY13_RS18110 (OFY13_18110) 1030401..1030652 - 252 WP_088124792.1 TIGR03643 family protein -
OFY13_RS18115 (OFY13_18115) 1030737..1030847 - 111 WP_082798255.1 DUF3265 domain-containing protein -
OFY13_RS18120 (OFY13_18120) 1030850..1031131 - 282 WP_234405718.1 type II toxin-antitoxin system death-on-curing family toxin -
OFY13_RS18125 (OFY13_18125) 1031251..1031421 - 171 WP_001080654.1 hypothetical protein -
OFY13_RS18130 (OFY13_18130) 1031503..1031940 - 438 WP_000503164.1 IS200/IS605-like element IS1004 family transposase -
OFY13_RS18135 (OFY13_18135) 1031984..1032247 - 264 Protein_907 GNAT family N-acetyltransferase -
OFY13_RS18140 (OFY13_18140) 1032318..1033507 + 1190 WP_088124793.1 IS3 family transposase -
OFY13_RS18145 (OFY13_18145) 1033517..1033840 - 324 Protein_909 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1003220..1033507 30287
- inside Integron - hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA 44..1062811 1062767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-152)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18527.18 Da        Isoelectric Point: 8.7753

>T263350 WP_000982260.1 NZ_CP110189:1028639-1029136 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RASLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9683.22 Da        Isoelectric Point: 6.2988

>AT263350 WP_000246253.1 NZ_CP110189:1028370-1028642 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLAKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQADAVLLMEALDNPAVVNAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0KGB1

Antitoxin

Source ID Structure
AlphaFold DB A0A0F2IC79

References