263349

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /DUF1778(antitoxin)
Location 1023570..1024369 Replicon chromosome
Accession NZ_CP110189
Organism Vibrio cholerae strain E1

Toxin (Protein)


Gene name - Uniprot ID Q9KM94
Locus tag OFY13_RS18025 Protein ID WP_000118351.1
Coordinates 1023570..1024103 (-) Length 178 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0K9UER4
Locus tag OFY13_RS18030 Protein ID WP_000179600.1
Coordinates 1024100..1024369 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OFY13_RS17980 (OFY13_17980) 1019391..1019918 - 528 Protein_876 DUF3800 domain-containing protein -
OFY13_RS17985 (OFY13_17985) 1019968..1020036 - 69 Protein_877 GNAT family N-acetyltransferase -
OFY13_RS17990 (OFY13_17990) 1020093..1020518 - 426 WP_002045007.1 GNAT family N-acetyltransferase -
OFY13_RS17995 (OFY13_17995) 1020654..1021043 - 390 WP_001081302.1 hypothetical protein -
OFY13_RS18000 (OFY13_18000) 1021218..1021460 - 243 WP_000107462.1 hypothetical protein -
OFY13_RS18005 (OFY13_18005) 1021668..1022585 - 918 WP_000186328.1 alpha/beta hydrolase -
OFY13_RS18010 (OFY13_18010) 1022821..1023123 - 303 WP_000229316.1 type II toxin-antitoxin system RelE/ParE family toxin -
OFY13_RS18015 (OFY13_18015) 1023111..1023368 - 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OFY13_RS18020 (OFY13_18020) 1023450..1023560 - 111 WP_100245224.1 DUF3265 domain-containing protein -
OFY13_RS18025 (OFY13_18025) 1023570..1024103 - 534 WP_000118351.1 GNAT family N-acetyltransferase Toxin
OFY13_RS18030 (OFY13_18030) 1024100..1024369 - 270 WP_000179600.1 DUF1778 domain-containing protein Antitoxin
OFY13_RS18035 (OFY13_18035) 1024592..1024963 - 372 WP_001164078.1 MazG nucleotide pyrophosphohydrolase domain-containing protein -
OFY13_RS18040 (OFY13_18040) 1025211..1025471 - 261 WP_032468027.1 DUF3709 domain-containing protein -
OFY13_RS18045 (OFY13_18045) 1025496..1025620 - 125 Protein_889 hypothetical protein -
OFY13_RS18050 (OFY13_18050) 1025630..1025746 - 117 WP_088124786.1 DUF3265 domain-containing protein -
OFY13_RS18055 (OFY13_18055) 1025743..1026360 - 618 WP_000695406.1 hypothetical protein -
OFY13_RS18060 (OFY13_18060) 1026562..1026688 - 127 Protein_892 DUF645 family protein -
OFY13_RS18065 (OFY13_18065) 1026685..1026810 - 126 WP_080388997.1 general secretion pathway protein GspH -
OFY13_RS18070 (OFY13_18070) 1027032..1027319 - 288 WP_000426470.1 hypothetical protein -
OFY13_RS18075 (OFY13_18075) 1027471..1028139 - 669 WP_000043871.1 hypothetical protein -
OFY13_RS18080 (OFY13_18080) 1028156..1028218 - 63 Protein_896 acetyltransferase -
OFY13_RS18085 (OFY13_18085) 1028370..1028642 + 273 WP_000246253.1 DUF1778 domain-containing protein -
OFY13_RS18090 (OFY13_18090) 1028639..1029136 + 498 WP_000982260.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1003220..1033507 30287
- inside Integron - hlyA / vgrG-3 / vasL / icmF/vasK / vasJ / vasI / vasH / clpB/vasG / vasF / vasE / vasD / vasC / vasB / vasA / VCA0109 / vipB/mglB / vipA/mglA / vgrG-2 / hcp-2 / hlyA / htpB / ugd / cqsA 44..1062811 1062767


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(97-153)

Antitoxin

Vibrio phage ICP1, Orf50

(5-81)


Sequences

Toxin        


Download         Length: 178 a.a.        Molecular weight: 20171.46 Da        Isoelectric Point: 9.1432

>T263349 WP_000118351.1 NZ_CP110189:c1024103-1023570 [Vibrio cholerae]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAHPLLNQKFAICAFYSVAPSSISRETLPA
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ

Download         Length: 534 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 9924.49 Da        Isoelectric Point: 4.9107

>AT263349 WP_000179600.1 NZ_CP110189:c1024369-1024100 [Vibrio cholerae]
MATARLDIRLDEEIKAKAEKASALLGLKSLTEYVVRLMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAV
KFTEKSGIK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9KM94

Antitoxin

Source ID Structure
AlphaFold DB A0A0K9UER4

References